Sunum yükleniyor. Lütfen bekleyiniz

Sunum yükleniyor. Lütfen bekleyiniz

Computational Biochemistry

Benzer bir sunumlar


... konulu sunumlar: "Computational Biochemistry"— Sunum transkripti:

1 Computational Biochemistry
Fatih University Computational Biochemistry

2 Outline Pubmed Retrieving DNA and Protein Sequences BLAST
Multiple Sequence Alignment Others (PDB, KEGG, BREND) Outline

3 Pubmed A scientific search engine
e-adress:http://www.ncbi.nlm.nih.gov/pubmed developed by the National Center for Biotechnology Information (NCBI) at the National Library of Medicine (NLM), located at the U.S. National Institutes of Health (NIH) A service that includes over 18 million citations from MEDLINE and other life science journals for biomedical articles back to PubMed includes links to full text articles and other related resources. Pubmed

4 bilimsel internet araştırması
bilimsel internet araştırması. O konu ile alakalı çıkmış bilimsel makaleleri araştırır Bilimsel araştırmalarda problemler çok fazla sonuç lüzumsuz sonuç Pubmed’in çözümü ileri arama opsiyonu limitasyon Pubmed ne yapar?

5 örnek: sorgu (query) gir.

6 Örnek Aramalar sorgu: bir yıl içinde pylori hakkında Türkiyede yapılan
ingilizce makaleler bedava makaleler Örnek Aramalar

7 “Server” hizmet vermekte en önemlisi NCBI ve expasy’de Amaç: ilgilendiğimiz bir proteinin protein sekansının bulunması En güvenilir: expasy iki database bulunmakta: Swiss-prot ve TrEMBL Swiss-prot: bire bir protein bilgileri uzmanlarca doldurulan TrEMBL: Bilgisayarlı Protein Sekansı Bulma

8 www.google.com expasy yaz tıkla
Expasy’e ulaşım

9 ister DNA ister protein sekansı olsun
ister DNA ister protein sekansı olsun. Sekansların tüm biyoenformatik araçları tarafından tanındığı sekans yazılım formatının adı FASTA formatıdır başta > işareti içerir ve sonrasında bilgilendirme gelir. ikinci satır sekansı içerir >sp|P41022|URE3_BACPA Urease subunit gamma OS=Bacillus pasteurii GN=ureA PE=1 SV=1 MHLNPAEKEKLQIFLASELLLRRKARGLKLNYPEAVAIITSFIMEGARDGKTVAMLMEEGKHVL TRDDVMEGVPEMIDDIQAEATFPDGTKLVTVHNPIS FASTA formatı

10 en iyi adres NCBI’ın genveri bankalarıdır.
DNA sekansı

11 NCBInucleotidesorguyu yaz Sorgu: urease pylori
örnek

12 BLAST: sekans karşılaştırma
değişik BLAST (basic local alignment search tool) yöntemleri var. BLAST: sekans karşılaştırma

13 BLAST neden kullanılır?
sekansınıza neler benziyor primer’larınız o bölgeye özgün mü? sekansınızın fonksiyonu bilinmiyorsa, tahmin alignment öncesi aday sekansları bulma BLAST neden kullanılır?

14 urease yapalım örnek

15 multiple (sekuence) alignment
birden fazla sekansı sıralarız (alignment) Ne faydası var: farklılık göstermeyenbölgeler tesbit edilir. yapı-fonskiyon ilişkisi filogenetik ağaç öncesi vb en çok kullanılan Clustal W, Tcoffee multiple (sekuence) alignment

16 expasy ile bir örnek örnek

17 Enzimlerle alakalı her türlü bilgi makalelerden çıkarılıp analşılır brenda: nasıl bulunur: google’dan brenda yaz ureaz’ı incele Enzim veri bankası

18 Kegg en popüler verbankası
Metobolisma

19 PDB Proteinlerin 3D’si


"Computational Biochemistry" indir ppt

Benzer bir sunumlar


Google Reklamları