Sunum yükleniyor. Lütfen bekleyiniz

Sunum yükleniyor. Lütfen bekleyiniz

Computational Biochemistry Fatih University. Outline Pubmed Retrieving DNA and Protein Sequences BLAST Multiple Sequence Alignment Others (PDB, KEGG,

Benzer bir sunumlar


... konulu sunumlar: "Computational Biochemistry Fatih University. Outline Pubmed Retrieving DNA and Protein Sequences BLAST Multiple Sequence Alignment Others (PDB, KEGG,"— Sunum transkripti:

1 Computational Biochemistry Fatih University

2 Outline Pubmed Retrieving DNA and Protein Sequences BLAST Multiple Sequence Alignment Others (PDB, KEGG, BREND)

3 Pubmed A scientific search engine e-adress:http://www.ncbi.nlm.nih.gov/pubmed  developed by the National Center for Biotechnology Information (NCBI) at the National Library of Medicine (NLM), located at the U.S. National Institutes of Health (NIH)  A service that includes over 18 million citations from MEDLINE and other life science journals for biomedical articles back to PubMed includes links to full text articles and other related resources.

4 Pubmed ne yapar? bilimsel internet araştırması. O konu ile alakalı çıkmış bilimsel makaleleri araştırır Bilimsel araştırmalarda problemler çok fazla sonuç lüzumsuz sonuç Pubmed’in çözümü ileri arama opsiyonu limitasyon

5 örnek: sorgu (query) gir.

6 Örnek Aramalar sorgu: bir yıl içinde pylori hakkında Türkiyede yapılan ingilizce makaleler bedava makaleler

7 Protein Sekansı Bulma “Server” hizmet vermekte en önemlisi NCBI ve expasy’de Amaç: ilgilendiğimiz bir proteinin protein sekansının bulunması En güvenilir: expasy iki database bulunmakta: Swiss-prot ve TrEMBL Swiss-prot: bire bir protein bilgileri uzmanlarca doldurulan TrEMBL: Bilgisayarlı

8 Expasy’e ulaşım expasy yaz tıkla

9 FASTA formatı ister DNA ister protein sekansı olsun. Sekansların tüm biyoenformatik araçları tarafından tanındığı sekans yazılım formatının adı FASTA formatıdır başta > işareti içerir ve sonrasında bilgilendirme gelir. ikinci satır sekansı içerir >sp|P41022|URE3_BACPA Urease subunit gamma OS=Bacillus pasteurii GN=ureA PE=1 SV=1 MHLNPAEKEKLQIFLASELLLRRKARGLKLNYPEAVAIITSFIMEGARDGKTVAMLMEEGKHVL TRDDVMEGVPEMIDDIQAEATFPDGTKLVTVHNPIS

10 DNA sekansı en iyi adres NCBI’ın genveri bankalarıdır.

11 örnek NCBI  nucleotide  sorguyu yaz Sorgu: urease pylori

12 BLAST: sekans karşılaştırma değişik BLAST (basic local alignment search tool) yöntemleri var.

13 BLAST neden kullanılır? sekansınıza neler benziyor primer’larınız o bölgeye özgün mü? sekansınızın fonksiyonu bilinmiyorsa, tahmin alignment öncesi aday sekansları bulma

14 örnek urease yapalım

15 multiple (sekuence) alignment birden fazla sekansı sıralarız (alignment) Ne faydası var: farklılık göstermeyenbölgeler tesbit edilir. yapı-fonskiyon ilişkisi filogenetik ağaç öncesi vb en çok kullanılan Clustal W, Tcoffee

16 örnek expasy ile bir örnek

17 Enzim veri bankası Enzimlerle alakalı her türlü bilgi makalelerden çıkarılıp analşılır brenda: nasıl bulunur: google’dan brenda yaz ureaz’ı incele

18 Metobolisma Kegg en popüler verbankası

19 Proteinlerin 3D’si PDB


"Computational Biochemistry Fatih University. Outline Pubmed Retrieving DNA and Protein Sequences BLAST Multiple Sequence Alignment Others (PDB, KEGG," indir ppt

Benzer bir sunumlar


Google Reklamları