Sunum yükleniyor. Lütfen bekleyiniz

Sunum yükleniyor. Lütfen bekleyiniz

BİYOİNFORMATİK. İçerik Biyoinformatik nedir Tarihçe Önemi Amaçları Uygulama alanları Veritabanları ve programları Biyoinformatik merkezleri.

Benzer bir sunumlar


... konulu sunumlar: "BİYOİNFORMATİK. İçerik Biyoinformatik nedir Tarihçe Önemi Amaçları Uygulama alanları Veritabanları ve programları Biyoinformatik merkezleri."— Sunum transkripti:

1 BİYOİNFORMATİK

2 İçerik Biyoinformatik nedir Tarihçe Önemi Amaçları Uygulama alanları Veritabanları ve programları Biyoinformatik merkezleri

3 Biyoinformatik Nedir?

4 Tanım Bilgisayarların moleküler biyolojide kullanımı Moleküllerin üç boyutlu grafik temsili Moleküler dizilimler Üç boyutlu yapı moleküler veritabanları Kısa sürede yüksek miktarda veri üretilmesi Protein-protein ilişkileri Biyolojik olarak aktif moleküllerin araştırılması Bakteri, maya, insan, hayvan, bitki genom projelerinden elde edilen bilgiler

5 Biyoinformatik Biyoinformatik İstatistik Bilgisayar Bilimleri Biyoloji Matematik

6 Biyoinformatik Araçları Veri bankası Mevcut veriler 1986’da 3939 iken 1999’da ’e çıkmış 2004 yılında kayıtlara göre yaklaşık veriye ulaşmıştır. Günümüzde yaklaşık ’i geçmiştir. 10 yıldır Biyoinformatik dalı ayrı bir bilim dalı olarak tanınıyor.

7 Biyoinformatik Araçlarının Kullanıldığı Metodolojik Çalışmalar DNA sıra ve dizilimi araştırmaları Protein sıra ve dizilimi araştırmaları Makromoleküler yapıların üç boyutlu dizilim araştırmaları Küçük moleküllerin ligandlarıyla etkileşiminin araştırılması Heterojen biyolojik veritabanlarının entegrasyonu Biyolojik enformasyon paylaşımının kolaylaştırılması Bilgisayar ile otomize edilmiş veri analizi ve iletimi Etkileşimde bulunan gen ürünleri için bilgi ağları oluşturulması Kimyasal reaksiyonlardan hücrelerarası iletişime kadar pek çok biyolojik faaliyet sürecinin simülasyonu Büyük çaplı biyolojik deneylerden (GENOM projeleri gibi) çıkan sonuçların analizi

8 Biyoinformatik Araçlarının Kullanıldığı Biyolojik Çalışmalar Protein yapı ve fonksiyonunun belirlenmesi Her hangi bir biyolojik fonksiyonu artıran veya azaltan moleküllerin tasarlanması Karmaşık genetik fonksiyon veya regülasyonun tanımlanması Tıbbi ya da endüstriyel amaçlı yeni makro moleküller üretmek Genetik faktörlerin hastalık yatkınlığına etkilerinin ortaya çıkarmak

9 Kapsamı 1.Biyolojik bilgiler ile ilgili veritabanı oluşturulup yönetilmesi 2.Genom ve dizi analizleri 3.İşlevsel genomik ve ilgili veri analizi 4.Birincil protein dizisinden protein 3 boyutlu tahmini 5.Hücresel olayların modellenip insliko gerçekleştirilmesi

10 Veri Tabanları

11 Veri Tabanı Programları 1.Tablolar 2.Formlar 3.Sorgular 4.Raporlar

12 Biyolojik Çeşitlilik Bacteria Fruit Fly Human Yeast

13 Biyoloji Veritabanları GenBank (Gen Bankası; ABD-Maryland-Bethesda) EMBL (Avrupa Moleküler Biyoloji Laboratuvarı; İngiltere-Hinxton) DDJB (DNA Japonya Veritabanı; Japonya-Mishima)

14 Gen ekspresyonu = Protein üretimi DNA

15 Gen ekspresyonu = Protein üretimi DNA Protein Nucleotides sequence

16 Protein dizi verileri ile ilgili başlıca hizmet sağlayıcılar 1.GenBank 2.EMBL 3.PIR International 4.Swiss-Prot

17 Sık Kullanılan Veritabanları SınıfVeri Tabanları Nükleik Asit Dizilişleri (DNA) EMBL GenBank Protein Dizilişleri (Protein) PDBSTR Swiss-Prot PIR PRF 3 Boyutlu YapılarPDB Diziliş Motifleri EPD TRANSFAC PROSITE Enzimler ve BileşiklerLIGAND Protein EtkileşimleriBRITE Biyokimyasal YollarPATHWAY Gen KataloglarıGENES Genetik HastalıklarOMIM Protein MutasyonlarıPMD Amino acid indicesAAindex Protein/peptid LiteratürüLITDB Biyotıp LiteratürüMEDLINE

18 Protein Dizisinden Yapısına APRKFFVGGNWKMNGDKK SLGELIHTLNGAKLSADT EVVCGAPSIYLDFARQKL DAKIGVAAQNCYKVPKGA FTGEISPAMIKDIGAAWV ILGHSERRHVFGESDELI GQKVAHALAEGLGVIACI GEKLDEREAGITEKVVFE QTKAIADNVKDWSKVVLA YEPVWAIGTGKTATPQQA QEVHEKLRGWLKSHVSDA VAQSTRIIYGGSVTGGNC KELASQHDVDGFLVGGAS LKPEFVDIINAKH

19 Pockets in Ribonuclease A

20 Dizi karşılaştırma 1: MYTAILORISRICH 2: MONTAILLEURESTRICHE 1: MY-TAIL--ORIS-RICH- ¦x ¦¦¦¦ x¦x¦ ¦¦¦¦ 2: MONTAILLEURESTRICHE ¦ = Identity x = Mismatch - = Insertion / Deletion 1: TAILO RICH ¦¦¦¦x ¦¦¦¦ 2: TAILL RICHE Global Alignment Two Local Alignments

21 MultipleSequenceAlignment(MSA) Programlar: CLUSTALW CLUSTALW T_COFFEE T_COFFEE MULTALIGN MULTALIGN HBA_CHICK VL-SAADKNNVKGIFTKIAGHAEEYGAETLERMFTTYPPTKTYFPHF-DL 48 HBAD_CHICK ML-TAEDKKLIQQAWEKAASHQEEFGAEALTRMFTTYPQTKTYFPHF-DL 48 HBPI_CHICK AL-TQAEKAAVTTIWAKVATQIESIGLESLERLFASYPQTKTYFPHF-DV 48 HBB_CHICK VHWTAEEKQLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNL 48 HBE_CHICK VHWSAEEKQLITSVWSKV--NVEECGAEALARLLIVYPWTQRFFASFGNL 48 HBRH_CHICK VHWSAEEKQLITSVWSKV--NVEECGAEALARLLIVYPWTQRFFDNFGNL 48 MYG_CHICK GL-SDQEWQQVLTIWGKVEADIAGHGHEVLMRLFHDHPETLDRFDKFKGL *... * * * *...* * * *.. HBA_CHICK SH-----GSAQIKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRV 93 HBAD_CHICK SP-----GSDQVRGHGKKVLGALGNAVKNVDNLSQAMAELSNLHAYNLRV 93 HBPI_CHICK SQ-----GSVQLRGHGSKVLNAIGEAVKNIDDIRGALAKLSELHAYILRV 93 HBB_CHICK SSPTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFSQLSELHCDKLHV 98 HBE_CHICK SSPTAIMGNPRVRAHGKKVLSSFGEAVKNLDNIKNTYAKLSELHCDKLHV 98 HBRH_CHICK SSPTAIIGNPKVRAHGKKVLSSFGEAVKNLDNIKNTYAKLSELHCEKLHV 98 MYG_CHICK KTPDQMKGSEDLKKHGATVLTQLGKILKQKGNHESELKPLAQTHATKHKI 99. *... **.* *.. *.. HBA_CHICK DPVNFKLLGQCFLVVVAIHHPAALTPEVHASLDKFLCAVGTVLTAKYR HBAD_CHICK DPVNFKLLSQCIQVVLAVHMGKDYTPEVHAAFDKFLSAVSAVLAEKYR HBPI_CHICK DPVNFKLLSHCILCSVAARYPSDFTPEVHAEWDKFLSSISSVLTEKYR HBB_CHICK DPENFRLLGDILIIVLAAHFSKDFTPECQAAWQKLVRVVAHALARKYH HBE_CHICK DPENFRLLGDILIIVLASHFARDFTPACQFAWQKLVNVVAHALARKYH HBRH_CHICK DPENFRLLGNILIIVLAAHFTKDFTPTCQAVWQKLVSVVAHALAYKYH MYG_CHICK PVKYLEFISEVIIKVIAEKHAADFGADSQAAMKKALELFRNDMASKYKEF * *... **. HBA_CHICK HBAD_CHICK HBPI_CHICK HBB_CHICK HBE_CHICK HBRH_CHICK MYG_CHICK GFQG 153 Consensus length: 154; Identity : 19 ( 12.3%); Similarity: 51 ( 33.1%) Character to show that a position in the alignment is perfectly conserved: '*' Character to show that a position is well conserved: '.'

22 Biyoinformatiğin önemli bir fonksiyonu, biyolojik olayların moleküler düzeyde açıklanmasına yardımcı olmasıdır. Patojen enzimleri veya mutasyona uğratılmış doğal enzimler, homoloji sayesinde modellenebilir ve bu modeller moleküler biyolojik olarak belirlenen etkilerin açıklanmasında kullanılabilir. Gen ekspresyon analizleri ile farklı hastalıklardan etkilenen hücrelerin ekspresyonları derlenerek, sağlıklı hücrelerinki ile kıyaslanmakta ve aradaki farklılıklardan hastalık teşhisi ve hedef ilaç dizaynında yararlanılmaktadır. Kişilerin gelecekteki sağlık durumları hakkında tahminde bulunmaya olanak verebilecektir. Tıp ve Farmakoloji Uygulamaları

23 Düzeltilmiş mutasyon analizleri (CMA) zincir çiftlerindeki ko- varisyasyonları bularak protein katlanma probleminin çözümünde kullanılabileceğini düşünmüşlerdir. Biyoinformatik sayesinde hastalıkların önlenmesinde önemli gelişmeler sağlanacaktır. Nükleotid dizilerinden translasyon yazılımı kullanılarak mümkün olan aminoasit dizileri belirlenebilir. Daha sonra model organizmalarda dizilim arama teknikleri yardımı ile homolog bölgeler belirlenir ve dizi benzerliklerinden yararlanılarak deneysel olarak karakterize edilmiş olan yapılar üzerinden insan proteinleri modellendirilebilir. Algoritma ile model yapıya bağlanabilen, gerçek proteinde biyolojik aktivitenin test edilebildiği molekülle ilaçlar tasarlanır.

24 Sonuç


"BİYOİNFORMATİK. İçerik Biyoinformatik nedir Tarihçe Önemi Amaçları Uygulama alanları Veritabanları ve programları Biyoinformatik merkezleri." indir ppt

Benzer bir sunumlar


Google Reklamları