Sunum yükleniyor. Lütfen bekleyiniz

Sunum yükleniyor. Lütfen bekleyiniz

Bakteri Genetiği 2015-2016, Bahar Yarıyılı, Trakya Üniv 6.kurul, 18.02.2016, Neşe Akış, PhD, Tıbbi Mikrobiyoloji Anabilim Dalı

Benzer bir sunumlar


... konulu sunumlar: "Bakteri Genetiği 2015-2016, Bahar Yarıyılı, Trakya Üniv 6.kurul, 18.02.2016, Neşe Akış, PhD, Tıbbi Mikrobiyoloji Anabilim Dalı"— Sunum transkripti:

1

2 Bakteri Genetiği , Bahar Yarıyılı, Trakya Üniv 6.kurul, , Neşe Akış, PhD, Tıbbi Mikrobiyoloji Anabilim Dalı

3 Yaşamımız ve bakteriler FAYDALILARZARARLILAR Antibiyotik makinalarıEnfeksiyon yapan bakteriler Protein farmasötik makinalarıZehirli bakteriler Vitamin makinalarıAntibiyotiğe dirençli bakteriler Çöp yiyen bakterilerTümör yapan bakteriler Mazot ve zift yiyen bakterilerŞişmanlatan ve diğer kronik hastalıklara sebep olan bakteriler Plastik yiyen bakteriler

4 1 Prokaryotik Genom

5 Replikon a)Bakteri genomu kromozomdur b)Bakteride ayrıca bakteriyi enfekte etmiş virüsler bulunur: Plazmid ve faj. Plazmid ile mutual ilişki sürer. Faj bakteriyi hasta eder. c)Kromozom ve plazmid genomu çift sarmal ve antiparalel DNA’dır, faj DNA veya RNA genoma sahip olabilir. d)Bakteri çoğalmasında çoğalan her bir genoma replikon denir. Bazı bakterilerde sadece kromozom replikon iken diğer bazılarında plazmid ve faj da replikondur Bakteri genom yapısı-1

6 Kromozom, a)Çoğu haploid b)Çoğu dairesel; Borrelia ve Streptomyces‘de lineer c) kilo nükleotid baz çifti (en küçük mikoplazmalar), ortalama 1,35 mm uzunlukta, insan genomunun 1/1000 boyunda d)Membrana bir ucundan yapışıktır e)Ortalama 360 a.a. uzunluğunda protein kodlayan adet gen taşır f)Kromozom kopya sayısı bakterinin değişik aşamalarında farklıdır. Çoğalma aşamasında DNA örneğin 8 adet genomdan kopyalanır (replikasyon olur). g)Replikasyon başlangıç noktasından başlar, yarı-korumalıdır (her sarmalden eşlenek üretilir) ve ortalama 40 dakika gibi kısa sürer, çünkü genomda farklı noktalardan eşzamanlı kopyalama yapılabilir. Bakteri genom yapısı-2

7 Kromozom, h)Benzer işlevli genler kendi adacıklarında kümelenir ve tek promotor altında birlikte ifade edilir (operon) i)Üzerinde gen geliştirme çalışması yapılan intronlar kaybedilir j)Katlanmada histon yerine küçük poliaminler ve Magnezyum iyonu benzer işlev görür. Super katlanma ile paketlenir. Buna nükleoit denir ve ökaryotik nükleus’un eşdeğeridir. 1.Genomun çekirdek membranı yoktur ama jelatinimsi bir oyuk içinde yerleşiktir 2.DNA eşlenme hataların için tamir mekanizması eksiktir, bu nedenle mutasyonlar kısmen tamir edilebilir Bakteri genom yapısı-3

8 Bakteri genom DNA’ları 1.Haploid dev kromozom, çoğunluğu dairesel çeşit ve her biri dinlenme halinde 1-4 kopya plazmid. Koromozomun 1/20 boyutunda. Her biri ihtiyaç halinde 400 kopyaya kadar çoğalabilir Savunma gen adası Virülans gen adası

9 E.Coli O157:H7 suş Sakai kromozomundan bir dizi (1392 baz) >gi|213695|gb|M |RANSALBU E.coli (O157) glucose mRNA, 3' end AAATGTCGTATTATTAGAGAATTTCCAGATATAGTTTTTAAAGGACTAACACTAGTTCAAGTCTCCC AAAAGTTTGGTAAGGCAGGGTTTGAAGATGTGAAAAAAGTCACCGAGGAAATTGTACATTTGAAT GAAGACTGTTGCAAAGGTGATGCTGTGGAATGTATGATGGAAAGGATGGAAGCCACCGATCATA TTTGTGAGGCTAAGGACAAATTATCATCCAAACTAGCTGACTGCTGTGCTAAAAGTATTCTAGAGC GAACACCCTGTCTTCTTGCCCTGCCAAACGATGAATCTGACTTGTCCAAAGAACTGAAAAATTATT ATGAAGATGAACGTGTGTGTGAGAACTATAAAAAAGACAAGTTATTATTCCTTGCCCACTTTACAC ACGATTATGCCAGAAGCCACCAGGAATCATCACCTCAGTCTTGTCTACGAGTTTCTAAAGGATTT GAAGGGTTGCTCGAAAAGTGCTGTGCTAGTGAAAACCATGCCGAGTGTCTCAAGCAAGCCCCTA TTTTGTTAGAGGCTGCACTGAAAGAAATTGAAGAGCTAAGGAAACAGAACTGTGGTGCCTTGCAG CTGCTCGGGTTCAGAGATTATAATATTCAGCTGCTTTTTCGATACTTTTTTAAGATGCCTCAGGTA ACGGCCCCAACGCTTGTTGAATTAGCTGGTAGAATGACCAAGGTTGCAGTCTACTGCTGTGGCTT GGCTGAGAACAAACAGCAAACCTGTGCTGAAGAAAAGCTGGATATTCTTTTGGGAGAGATGTGC GAAAAGGAAAAGCATACATTCGTAAATGACAATGTTCGCCATTGTTGCGTCGACTCATATGCTAAT AGAAGAAAATGCTTCACTGATCTTCAACGTTATCCTAATTATGTAGCGCCCAAGTGGGATGAAAGT AAGCTCCACTTTAATGAGGACTTATGTAAAGGTTCCGAAGATGACCAGATAAAGAAGAAACTGGA AGTGTTGGTTGAATACATGAAAATGAAGCCTGACTGTGGGCCAGAAAAACTTAAAGAGGTTGTTG AAGCCTTTAGAAAAATAGATATAAAATGCTGCGCAGCAGAGGACCACCAGAAATGCTTTGATGAC GAGAAAGCAGGCCTTCTTCAAATAATTGAGGCCCATTAACATGGAACAGGCCACAAGCTAATATA ACAAGACAGCCTTGAGCCACTAGGTTAAATCATCATCAACTGGTCACTGAATACATGTTGCTGATA CATGTCTCTGAAGACTCAAGTAGAAAAAAACTACCATCGTTTTACTGCAAAATAATAAAAAAATAAA TTCTTTATGACCAGAAAAAAA Translasyon= KCRIIREFPDIVFKGLTLVQVSQKFGKAGFEDVKKVTEEIVHLNEDCCKGDAVECMMERM EATDHICEAKDKLSSKLADCCAKSILERTPCLLALPNDESDLSKELKNYYEDDLQRYPNY VAPKWDESKLHFNEDLCKGSEDDQIKKKLEVLVEYMKMKPDCGPEKLKEVVEAFRKIDI KCCAAEDHQKCFDDEKAGLLQIIEAH

10 Plazmid özellikleri 1.Tüm bakterilerde bilinen ~1000 çeşit vardır 2.Uzun zaman ihtiyaç olmayan plazmid kromozoma entegre olarak uykuya geçer (profaj) 3.Bakteri zora girdiğinde plazmidler bakteriyi terk eder

11 Her plazmid belli işleve ait gen seti taşır 1.Antibiyotik direnç genleri (R geni) taşıyan 2.Konjugasyon düzenleyici taşıyan 3.Metabolizma genleri taşıyan 4.Toksin, bakteriyosin genleri taşıyan 5.Onkojenik aktiviteleri yapan plazmid 6.Dişte yerleşim genli plazmidi 7.Konak metabolizmasını kontrol plazmidi

12 Operon örgütlenmesi Bakteri genomunda aynı işin gerçekleştirilmesinde kullanılacak işbirliği genleri ardarda tek set olarak dizilidir. İhtiyaç halinde bu set ifade edilir. Setteki gen ürünleri traskripsiyon veya translasyon sonrası birbirinden ayrılır.

13 Bakteri operon ifadesi için uyarılar Bakteri algaçları (reseptörleri): Sıcaklık değişti mi? Nem değişti mi? Basınç değişti mi? Toksin var mı? Besin azaldı mı? pH değişti mi? Faj geldi mi? Nüfus kalabalıklaştı mı?

14 Bakteri kararları Virülans Aktive edilen operon Metabolizma ekonomisi Özgül katabolizma Konak içinde Toprakta Besin bol Savaş alanı Tehlike var Enfeksiyon Bakterisid + Transformasyon + Mutasyon Hangisi? Stres yanıtı Hangi faj? Özgül savunma Olay/yer tahmini Biyofilm

15 Bakteri operonlarından örnekler Glikoz kullanma operonu Laktoz kullanma operonu Triptofan üretme operonu Enerji metabolizması ile ilgili operon Çoğalma ile ilgili operonlar (eşlenme, bölünme vs) Yapışma molekülleri operonu Stres yanıtı operonu Savunma operonları Virülans operonu Bakterisidal üretim operonu İskelet yapım operonu Sekresyon operonları Duvar sentez operonu Antibiyotik direnç operonları

16 2 Bakteriler nasıl antibiyotik direnci geliştirmektedir ?

17 Savaşan bakteriler rakip kabilenin antibiyotiği ile karşılaştığında hangi kader olasılıkları mümkündür? 1.Hepsi ölür, belki biri savaş alanından uzaklaşabilir 2.Başarılı direnç geni üretme ümidiyle hemen mutasyona başlarlar, belki biri bunu başarır ve çoğalır 3.Belki biri rakipteki direnç genini transformasyon ile edinir ve çoğalır

18 Toksik uyarı alan bakteri Uyarı adaptasyon genleri aktive Antibiyotik direnç adasındaki genler alktive Genel savunmanın başarılı başarısız başarılı başarısız Stres yanıtı O.K. Direnç genlerinde mutasyonun indüklenmesi başarılıbaşarısız Bakteri yeni dirençle evrilmiştir ölür

19 Bakteride direnç evrimi Bakteriyologlar evrim ile gündelik karşılaşırlar. Bir petrideki bakterilerin üzerine biraz antibiyotik döküldüğünde önce hepsi ölmüş gibidir ama nadir evrilmiş bir dirençliye rastlamak mümkün olabilir. Bu nadir bakteride işe yarar mutasyon gelişmiştir. Hızla çoğalır Transformasyon veya mutasyonla direnç kazanan bakteriye F+ diyoruz. Bu bakteri konjugasyonla yeni geni akrabalarına aktarır.

20 Zahmetsiz direnç geni kazanmanın bir diğer yolu: Transdüksiyon Bakteriye enfeksiyon yapan faj başka bir yerden direnç geni çalmış ve taşıyor olabilir. Faj kromozoma entegre olduğunda direnci bakteriye hediye etmiş durumdadır. Faj, transpozon aktiviteli ise kromozomda kopyalarını oraya buraya dağıtır, direnç geni de çoğalır.

21 ANTİBİYOTİĞE KARŞI DİRENÇ ÖZET

22 ANTİBİYOTİK BAKTERİYE NASIL ZARAR VERİR? duvarı bozartranskripsiyon sistemini bozar duvar tamir sistemini bozar metabolik sistemi bozar

23 ANTİBİYOTİĞE DİRENÇ GENLERİNİN ÇEŞİTLERİ içeri giren antibiyotikleri parçalayan enzim içeri girişlere dayanıklı duvar sentezleyici içeri giren antibiyotikleri dışarı atan pompa

24 ANTİBİYOTİĞE DİRENÇ GENLERİNİ EDİNME MUTASYONLARI Hipermutasyon ile gen edinme Konjugasyonla gen kazanma Transformasyonla gen kazanma Transdüksiyonla gen kazanma

25 3 Neden bazı bakteriler virüsler gibi zorunlu hücreiçi yaşamaya mahkumdur?

26 Eksik genliler Genleri yeterli olmayan bazı bakteriler konağın gen ürünlerine bağlı yaşayabilirler. Bunlara zorunlu hücreiçi bakteri denir. Hücreiçi bakteriler yaşamak için güçlü virülans stratejileriyle bir konağa girmek zorundadır. Bu nedenle havasız yaşayan (anaerop) bu bakteriler konağın derin dokularında tehlikelidirler.

27 HÜCREİÇİ ANAEROBİK ORTAMDIR

28 Mikropların vücutta yer tercihi Serbest dolaşan MİKROP (hücredışı parazitoz) Hücrenin içi MİKROP dolu (hücreiçi parazitoz) Bakteriler (bazı) Mantarlar (bazı) Protozoonlar (bazı) Helmintler Virüsler Bakteriler (bazı) Mantarlar (bazı) Protozoonlar (bazı) Mikrobun tahribi hedeflenirHücrenin tahribi hedeflenir Helmint Tümör

29 Seçmenli (fakültatif) bakteri Eksik genleri nedeniyle zorunlu anaerobik bakteri sadece hücre içinde yaşar. Seçmeli anaerobik bakteri ise oksijen varsa aerobik yoksa fermantasyon solunumu yaptığından hücre dışında olduğu kadar hücre içinde de yaşar. M.tuberculosis, Listeria, Legionella, Enterobacteriacea üyeleri gibi. Herikisi de mikobakteri olduğu halde M. leprae sadece hücre dışında yaşayabilir.

30 M. tuberculosis ve M. leprae M. tuberculosis ve M. leprae danaları enfekte etmek üzere bir toprak bakterisinden evrimleşmiş ve 10,000 yıl önce insanların hayvancılığa başlamasıyla insanlara dadanmıştır. En küçük genomlu: E. coli M. tuberculosisM. leprae Genom boyutuBilinen en büyüklerdenorta Gen sayısı3,9241,604 Genomun gen doluluk oranı90.8%49.5% Yalancı gen61116 Kaybedilen gen sayısı0>2,000 Üreme sıklığı18-24 s14 g

31 Listeria’yı hangi yanıt daha iyi yok eder ? Enfekte hücrenin hedeflenmesi Bakterinin hedeflenmesi

32 4 Virülans genleri

33 Virülans adaları Patojen bakteri demek virülans gen adası bulunduran bakteri demektir Virülans adaları bakteriden çıkarılarak bakterinin zararsız formları elde edilebilir Virülans adaları mühendislikle çıkarılan bakteriler moleküler biyolojide masum bakteri olarak kullanılır


"Bakteri Genetiği 2015-2016, Bahar Yarıyılı, Trakya Üniv 6.kurul, 18.02.2016, Neşe Akış, PhD, Tıbbi Mikrobiyoloji Anabilim Dalı" indir ppt

Benzer bir sunumlar


Google Reklamları