Sunum yükleniyor. Lütfen bekleyiniz

Sunum yükleniyor. Lütfen bekleyiniz

Sağlık Hizmetleri Meslek Yüksekokulu Dergisi İnönü Üniversitesi Adına Sahibi: Owner on behalf of İnönü University: Editör/Editor: Doç.Dr.Emine ŞAMDANCI.

Benzer bir sunumlar


... konulu sunumlar: "Sağlık Hizmetleri Meslek Yüksekokulu Dergisi İnönü Üniversitesi Adına Sahibi: Owner on behalf of İnönü University: Editör/Editor: Doç.Dr.Emine ŞAMDANCI."— Sunum transkripti:

1 Sağlık Hizmetleri Meslek Yüksekokulu Dergisi İnönü Üniversitesi Adına Sahibi: Owner on behalf of İnönü University: Editör/Editor: Doç.Dr.Emine ŞAMDANCI Editör Yardımcıları/Assoc. Editors: Yrd. Doç. Dr. Z. Deniz YAKINCI Öğr.Grv. Remziye AYDIN Yayın Kurulu/Editorial Board Prof.Dr. Ahmet KIZILAY Prof. Dr. Behice ERCÜ Prof.Dr. Fatma UYANIK Prof.Dr. Mustafa ŞENOL Prof. Dr. Nasuhi EnginAYDIN Prof. Dr. Nigar VARDI Prof.Dr. Sevcan AKESİ Doç. Dr. A.Ferda DAĞLI Doç. Dr. Ali ÖZER Doç.Dr. Gülden SINMAZIŞIK Doç.Dr. Hakan PARLAKPINAR Yrd. Doç.Dr. Meral YÜKSEL Yrd. Doç.Dr. Nuran AKYURT Biyoistatistik Danışmanı Doç.Dr. Cemil ÇOLAK Dil Danışmanları Prof.Dr. Ahmet KIZILAY Prof.Dr. Mustafa ŞENOL Yayın Sekreteri/Publication Secratary: Okan ÇELİK Yazışma Adresi/Correspondence Addres: İnönü Üniversitesi Sağlık Hizmetleri Meslek Yüksekokulu Merkez Kampüsü/44280 MALATYA E-posta: Tel/Faks:

2 İÇİNDEKİLER 1-SAĞLIK SEKTÖRÜNDE HALKLA İLİŞKİLER ve İLETİŞİM UYGULAMALARINA GENEL BİR BAKIŞ Sinem SOMUNOĞLU, Mevlana Celaleddin ERDOĞAN, Pınar ÖZER DENEYSEL DİYABETİN SIÇAN KALP DOKUSUNDA MEYDANA GETİRDİĞİ HİSTOLOJİK DEĞİŞİKLİKLER ÜZERİNE AMİNOGUANİDİNİN İYİLEŞTİRİCİ ETKİLERİ Aslı ÇETİN, Nigar VARDI, Doğan ORMAN RENAL REPTÜRE HEMORAJİK ANJİOMYOLİPOMLARDA KONSERVATİV YAKLAŞIM Bayram KAHRAMAN, Cemal TAŞDEMİR, Caner EDİZ, Ayşegül KAHRAMAN, Ramazan ALTINTAŞ, Mustafa KANBAY ELASTOFİBROMA: 2 OLGU SUNUMU Zehra BOZDAĞ, Neslihan KÖKTEN, Nurhan ŞAHİN, Ayşe Nur AKATLI KONJENİTAL SEMİNAL VEZİKÜL KİSTİ: OLGU SUNUMU Ayşegül KAHRAMAN, Caner EDİZ, Cemal TAŞDEMİR, Bayram KAHRAMAN, Ramazan ALTINTAŞ, Mustafa KANBAY GASTİRİK KSANTOMA:NADİR BİR LEZYON Candan Elmalı,Emine Şamdancı(Türkmen),Zeynep Nurkabulov,Ayşe Nur Akatlı, Nurhan Şahin AKILCI (RASYONEL) İLAÇ KULLANIMI Seda TAŞDEMİR

3 AKADEMİK YAYIN KURULU Prof.Dr. Abdullah AYDIN Medeniyet Üniversitesi Tıbbi Patoloji Anabilim Dalı, İstanbul Prof.Dr. Aysel Köksal AKYOL Ankara Üniversitesi Çocuk Gelişimi Bölümü Prof.Dr. Ayşe AYDOĞDU Gazi Üniversitesi Fizik Anabilim Dalı Prof.Dr. Behice ERCİ İnönü Üniversitesi Malatya Sağlık Yüksekokulu Prof.Dr. Eyüphan YAKINCI İnönü Üniversitesi Fen Edebiyat Fakültesi Fizik Anabilim Dalı Prof.Dr. Gülen BARAN Ankara Üniversitesi Çocuk Gelişimi Bölümü Prof.Dr. İbrahim Halil ÖZEROL İnönü Üniversitesi Mikrobiyoloji Anabilim Dalı Prof.Dr. Mahmut DURMUŞ İnönü Üniversitesi Anestezi ve Reanimasyon Anabilim Dalı Prof.Dr. Nasuhi Engin AYDIN İnönü Üniversitesi Patoloji Anabilim Dalı Prof.Dr. Nigar VARDI İnönü Üniversitesi Histoloji Anabilim Dalı Prof.Dr. Sedat YILDIZ İnönü Üniversitesi Fizyoloji Anabilim Dalı Prof.Dr. Süheyla ÜNAL İnönü Üniversitesi Psikiyatri Anabilim Dalı Doç.Dr. Adile Ferda DAĞLI İnönü Üniversitesi Patoloji Anabilim Dalı Doç.Dr. Ali BEYTUR İnönü Üniversitesi Turgut Özal Tıp Merkezi Üroloji Anabilim Dalı Doç.Dr. Ali ÖZER İnönü Üniversitesi Halk Sağlığı Anabilim Dalı Doç.Dr. Aynur BÜTÜN AYHAN Ankara Üniversitesi Çocuk Gelişimi Bölümü Doç.Dr. Aytaç YÜCEL İnönü Üniversitesi Anestezi ve Reanmasyon Anabilim Dalı Doç.Dr. Cemil ÇOLAK İnönü Üniversitesi Tıp Fakültesi Biyoistatistik ve Tıp Bilişimi AD Doç.Dr. Derya DOĞAN İnönü Üniversitesi Pediatri Anabilim Dalı Doç.Dr. Erkan KARATAŞ İnönü Üniversitesi KBB Anabilim Dalı Doç.Dr. Hakan PARLAKPINAR İnönü Üniversitesi Farmakoloji Anabilim Dalı Doç.Dr. M. Gökhan TURTAY İnönü Üniversitesi İlk ve Acil Yardım Anabilim Dalı Doç.Dr. Nusret AÇIKGÖZ İnönü Üniversitesi Kardiyoloji Anabilim Dalı Doç.Dr. Yusuf YAKUPOĞULLARI İnönü Üniversitesi Tıbbi Mikrobiyoloji Anabilim Dalı Yrd.Doç.Dr. Cemal TAŞDEMİR İnönü Üniversitesi Üroloji Anabilim Dalı Yrd. Doç.Dr. Ergül ALÇİN İnönü Üniversitesi Fizyoloji Anabilim Dalı Yrd. Doç.Dr. Evren KÖSE İnönü Üniversitesi Anatomi Anabilim Dalı Yrd.Doç.Dr. Fatih OĞUZ İnönü Üniversitesi Üroloji Anabilim Dalı Yrd.Doç.Dr. Haluk SÖYLEMEZ Dicle Üniversitesi Üroloji Anabilim Dalı Yrd.Doç.Dr. Hasan GÖKÇE Hatay Üniversitesi Patoloji Anabilim Dalı Yrd.Doç.Dr. M.Said AYDOĞAN İnönü Üniversitesi Anestezi ve Reanmasyon Anabilim Dalı Yrd.Doç.Dr Mehmet Fatih KORKMAZ İnönü Üniversitesi Ortopedi ve Travmatoloji Anabilim Dalı Yrd.Doç.Dr. Muharrem AK İnönü Üniversitesi Tıp Fakültesi Aile Hekimliği Anabilim Dalı Yrd.Doç.Dr. Nurhan ŞAHİN İnönü Üniversitesi Pataloji Anabilim Dalı Yrd.Doç.Dr. Pembegül FIRAT İnönü Üniversitesi Göz Anabilim Dalı Yrd.Doç.Dr. Ramazan ALTINTAŞ İnönü Üniversitesi Tıp Fakültesi Üroloji Anabilim Dalı Yrd.Doç.Dr. Seda TAŞDEMİR İnönü Üniversitesi Farmakoloji Anabilim Dalı Yrd.Doç.Dr. Sermin TAŞHAN İnönü Üniversitesi Sağlık Yüksekokulu Yrd.Doç.Dr. Turan YILDIZ Sakarya Üniversitesi Çocuk Cerrahisi Anabilim Dalı Yrd.Doç.Dr. Yeliz ÇETİNKOL Ordu Üniversitesi Tıbbi Mikrobiyoloji Anabilim Dalı Yrd.Doç.Dr. Zehra BOZDAĞ Gaziantep Üniversitesi Patoloji Anabilim Dalı Yrd.Doç.Dr. Z. Deniz YAKINCI İnönü Üniversitesi Sağlık Hizmetleri Meslek Yüksekokulu Uzm.Dr. İsmal ÖRS Karaman Devlet Hastanesi Cildiye polikiliniği 3

4 Sinem SOMUNOĞLU 1, Mevlana Celaleddin ERDOĞAN 2, Pınar ÖZER 3 1 Uludağ Üniversitesi Sağlık Hizmetleri Meslek Yüksekokulu, Görükle Kampusu, Nilüfer/ BURSA. 2 İl Halk Sağlığı Müdürlüğü, Aksaray 3 İl Sağlık Müdürlüğü Basın ve Halkla İlişkiler Birimi, Aydın Özet: Halkla ilişkiler ve iletişim alanında yapılan çalışmalar; hem kamu hem de özel sektör kurumları tarafından benimsenmektedir. Bu çalışmalar; kişileri tanımak, desteğini kazanmak amacı ile yürütülmektedir. Sağlık sektörünün aşırı uzmanlaşma, işlevsel bağımlılık, hasta memnuniyeti vb. kendine özgü birtakım özellikleri bulunmaktadır. Günümüzde halkla ilişkilerin ve iletişimin sağlık sektöründe giderek artan oranda önem kazandığı görülmektedir. Bu çalışmada; sağlık sektöründe yürütülen halkla ilişkiler ve iletişim faaliyetlerine ilişkin, sektörde çalışacak olan öğrencilerin görüşlerinin belirlenmesi amaçlanmıştır. Araştırmanın evrenini bir ilde bulunan üniversitesinin tıbbi dokümantasyon ve sekreterlik programına kayıtlı öğrenciler oluşturmuştur. Araştırmada anket yöntemi kullanılmış ve ankette öğrencilerin sosyo - demografik özellikleri ile sağlık sektöründe halkla ilişkiler ve iletişimin önemi, etkili olan iletişim kanalları ve engelleri ile ilgili sorulara yer verilmiştir. Araştırma sonucunda elde edilen bulgular incelendiğinde; öğrencilerin %93,0’ının sağlık sektöründe halkla ilişkilerin %100,0’ı iletişimin önemli olduğunu düşündüğü, ancak buna karşılık sağlık sektöründe hem halkla ilişkilere (%58,1) hem de iletişime (%51,2) yeterince önem verilmediğini ifade ettikleri görülmektedir. Bunun dışında öğrencilere göre hasta beklentilerinin öğrenilmesi için hasta memnuniyeti araştırmaları yapılmalı (%53,5) ve yüz yüze iletişim benimsenmelidir. Sağlık sektöründeki temel iletişim engeli ise yeterince net verilmeyen mesajlar olarak tanımlanmıştır (%44,2). Anahtar Kelimeler: Halkla ilişkiler, iletişim, sağlık sektörü, tıbbi dokümantasyon ve sekreterlik öğrencileri. AN OWERVIEW OF THE HEALTH SECTOR PUBLIC RELATIONS AND COMMUNICATION PRACTICES Abstract: Public relations and communication studies are adopted by both public and private sector institutions. These studies are carried out to identify the people and feel the supports of them. There are a number of unique features of the health sector such as excessive specialization, functional dependency, patient satisfaction, and so on. Today, it is seen that public relations and communication in the health sector increasingly gain importance. In this study, it is aimed that to determine the opinions of the student related with public relations and communication practices. The research population consisted of students of medical documentation and secretarial program. To achieve the objective of the study the questionnaire was used. This questionnaire consisted of some questions related with socio-demographic characteristics of the students, importance of the public relations and communication and also communication channels and barriers. The findings of the research are examined it was found that 93.0% and 100.0% of the students thought that public relations, and communication are important in health sector. But they said that it wasn’t given enough attention to public relations (58.1%) and communication (51.2%). Otherwise, according to the students to learn expectations of the patients, patient satisfaction surveys are made (53.5%) and face to face communication should be adopted. Key Words: Public relations, communication, health sector, medical documentation and secretaryship students Aralık 2008 tarihleri arasında Uludağ Üniversitesi tarafından düzenlenen V.Ulusal Öğrenci Kongresi’nde sözel bildiri olarak sunulmuştur. 4 SAĞLIK SEKTÖRÜNDE HALKLA İLİŞKİLER ve İLETİŞİM UYGULAMALARINA GENEL BİR BAKIŞ SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Sinem SOMUNO Ğ LU ve ark.

5 GİRİŞ nazaran daha büyük önem taşıdığı ve olumlu bir imajın yaratılması sürecinde planlı şekilde yürütülen iletişim Günümüzde gerek toplumsal ve ekonomik gerekse teknolojik alanda hızlı değişimlerin ve yoğun bir rekabetin yaşandığı düşünüldüğünde, örgütlerin varlıklarını devam ettirme sürecinde çevresel değişimlere göre gerekli düzenlemeleri yapmaları ve toplumun beklentilerine yanıt vermeleri büyük önem taşımaktadır. Bu faaliyetlerin yürütülmesi sırasında örgütlerin kullandıkları yöntemlerden biri de halkla ilişkilerdir (1). Halkla ilişkiler genel anlamda; halkı aydınlatmak, bir kuruma yönelik iyi niyet ve itibarı geliştirmek ve hedef kitlenin zihninde kurum hakkında olumlu bir imaj yaratmak için yürütülen faaliyetler bütünü olarak ifade edilmektedir. Bu faaliyetlerin yürütülmesinde; kurum ile toplumun karşılıklı çıkarları açısından çift yönlü bir haberleşme ve bilgi alışverişine dayalı dengenin sağlanması ön plana çıkmaktadır. Bir diğer ifadeye göre de halkla ilişkiler, kamuoyunu etkileme ve kamuoyundan etkilenme sürecidir (2). Halkla ilişkilerin bir diğer işlevi de yönetimin bilme ve tanıma eksikliğini gidermek olarak tanımlanmaktadır ki, bunun temelinde de, toplumun farklı kesimlerinin beklentilerinin yönetim tarafından öğrenilmek istenmesi yatmaktadır. Bu durum halkla ilişkiler uygulamalarının bir yönetim süreci olarak ele alınmasını da beraberinde getirmiştir (1). Halkla ilişkiler faaliyetlerinin yürütülmesi sırasında uyulması gereken birtakım temel ilkeler bulunmaktadır. Bu ilkeler incelendiğinde; çalışmalarınınetkisininbüyük olduğu yürütülen ilişkin ifade halkla olarak edilmektedir. Sağlık kurumlarında ilişkilerilişkilerfaaliyetleri;hastalığa kamuoyunun bilgilendirilmesinden mücadele etme ve korunmayollarınınanlatılmasına,hasta memnuniyetinin sağlanmasından hasta haklarına ilişkin bilgi sahibi olunmasına kadar oldukça geniş bir alanı kapsamaktadır (4). Bu bilgilere ek olarak, sağlık sektöründe halkla ilişkiler uygulamalarını zorunlu kılan bazı nedenlerin varlığından da bahsedilmektedir. Bu nedenler; sağlık sektörünün karmaşık yapısı, uzmanlaşma seviyesinin yüksekliği, yoğun tıbbi terminoloji kullanımı, hedef kitlenin bilgisizliği, yönetiminprofesyonelleşmesi vb.şeklinde sıralanabilmektedir. Ayrıca, sağlık sektörünün hedef kitlesi durumunda olan hasta ve yakınlarının gerek fiziksel ve psikolojik yapılarının gerekse beklentilerinin farklı olması, hastaneye başvuru yapanların sıkıntı, huzursuzluk, endişe, gerginlik vb. duygu değişimleri yaşaması da sağlık sektörü açısından halkla ilişkilerin önemini artıran diğer faktörler arasında yer almaktadır (1). İletişim de halkla ilişkilerin temel öğelerinden biri olarak kabul edilmekte, etkili bir halkla ilişkiler çalışmasının yürütülmesinde çift yönlü işleyen açık iletişim kanallarının varlığına vurgu yapılmaktadır (1, 5, 6). Bu açıdan bakıldığında iletişim; duygu, düşünce, bilgi ve becerilerin paylaşıldığı ve en az iki kişiyle TümTümçalışmalarınşeffaf dürüstlük olarak ilkesinin gerçekleşenbiretkileşimetkileşimsüreci olarak  yürütülmesinin ve benimsenmesinin, tanımlanmaktadır (1, 5). Etkili bir iletişimin gerçekleşmesinde, verilen mesajların hedef kitle tarafından bozulmadan anlaşılması önem kazanmakta, hangi mesajın kime ve hangi araçlar ile verileceği saptanmakta ve geribildirimin alınmasına bağlı olarak da süreç tamamlanmış olmaktadır (7). Bu aşamada unutulmaması gereken husus, halkla ilişkiler çalışmalarının ancak verimli bir şekilde işleyen iletişim süreci sayesinde başarıya ulaşmasının mümkün olacağıdır (6). Aksi takdirde iletişim sürecinde yaşanan aksaklıkların sonucunda, gerginliğin oluşması ve çatışmanın yaşanması kaçınılmaz olacaktır (5). Sağlık sektörü açısından bakıldığında da iletişimin önemi ortaya çıkmakta, gerek sağlık sektöründe  çift yönlü bir iletişimin olmasının, gerçeklerin yansıtılmasının, halkla ilişkilerin ayrı bir uzmanlık alanıalanı olarak değerlendirilmesinin ve faaliyetlerin bilimsel temellere oturtulmasının, faaliyetlerin süreklilik arz etmesinin, mesleki etik kurallara uyulmasının ve halkla ilişkilerin değerinin ve amacının tüm  çalışanlar tarafından kabul edilmesinin önemli olarak görüldüğü ortaya çıkmaktadır (3). Sağlık sektöründe faaliyet gösteren kurumlar açısından bakıldığında ise, hedef kitleye ulaşılmasının ve onlarda istenilen değişikliğin yaratılmasının diğer kurumlara çalışanlarıngereksehastalarınbeklentilerinin 5 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Sinem SOMUNO Ğ LU ve ark.

6 öğrenebilmesi için çalışanlar ile hastaların arasında çift yönlü bir iletişim kurulmasının gerekliliğine dikkat çekilmektedir (4, 8). Hedef kitlenin değerlerine özen gösterilmesi, sağlık hizmetlerine ilişkin farkındalık yaratılması, sağlıklı yaşam biçiminin yaygınlaştırılması ve toplumda davranış değişikliğinin oluşturulması sürecinde etkin bir iletişimin kurulmasının önemli olduğuna işaret edilmekte, bu gelişmelerin uzun dönemde olumlu kurum imajının oluşmasına da katkı sağlayacağına yer verilmektedir (4). Bu düşüncelerden hareketle; hazırlanan çalışmada mezuniyet sonrası sağlık sektöründe görev yapacak olan Araştırmanın evrenini Zonguldak ilinde yer alan Bülent Ecevit Üniversitesi Sağlık Hizmetleri Meslek Yüksekokulu Tıbbi Dokümantasyon ve Sekreterlik Programı’nda 2008 yılı itibari ile eğitim gören I. ve II. sınıf öğrencileri (n=43) oluşturmaktadır. Araştırma için gerekli izinlerin alınmasından sonra, örneklem seçilmemiş, evrenin tümüne ulaşılması hedeflenmiştir. Araştırmada veri toplama aracı olarak yapılan literatür incelemesi sonucunda araştırmacılar geliştirilen anket kullanılmış, ankette sosyo-demografik özelliklerine, sağlık tarafından öğrencilerin sektöründe halkla ilişkiler ve iletişim uygulamalarının önemine, hastalar, sağlık personeli ve üstlerle kurulacak iletişimde etkili olan iletişim kanallarına ve iletişim engellerine ilişkin sorulara yer verilmiştir. Araştırma sonucunda ulaşılan veriler SPSS 13.0 istatistik programına aktarılmış ve bulguların analizinde frekans öğrencilerin bakış açısına göre halkla ilişkiler iletişim faaliyetlerinin değerlendirilmesi istenmiştir. veve YÖNTEM Sağlık sektörünün kendine has özellikleri göz önüne alındığında, halkla ilişkiler ve iletişim uygulamalarının büyük önem taşıdığı görülmektedir. Yapılan çalışmada mezuniyet sonrası sektörde görev alacak öğrencilerin sağlık sektöründe halkla ilişkiler ve iletişim uygulamalarına ilişkin bakış açılarının saptanması ve önerilerinin belirlenmesi amaçlanmıştır. veveyüzdeyüzdegibitanımlayıcıistatistiklerdenistatistiklerden yararlanılmıştır. BULGULAR Tablo 1: Öğrencilerin Sosyo-Demografik Özelliklerine Göre Dağılımı (n=43) Tablo 1 incelendiğinde; öğrencilerin %53,5’inin yaş grubunda yer aldığı, %76,7’sinin kız öğrencilerden oluştuğu, %51,2’sinin 1. dönem öğrencisi olduğu ve aylık harcama miktarının 201 TL ve üzerinde yer aldığı, %55,8’inin de düz lise mezunu olduğu görülmektedir. 6 DEĞİŞKENLERSayıSayı% Yaş Grubu yaş arası232353,5 21 yaş ve üstü202046,5 Cinsiyet KızKız376,7 ErkekErkek101023,3 Dönemi 1.Dönem251,2 3.Dönem212148,8 Aylık Harcama Miktarı (TL) ≤100 TL24,64, TL191944,2 201 TL ve üstü201 TL ve üstü251,2 Öğrenim Durumu Sağlık Meslek Lisesi511,6 Düz LiseDüz Lise242455,8 Anadolu Lisesi37,07,0 Diğer (yabancı dil, süper lise vb.)125,6 Toplam ,0100,0 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Sinem SOMUNO Ğ LU ve ark.

7 Tablo 2:Öğrencilerin Sağlık Sektöründe Halkla İlişkiler ve İletişimin Önemine Yönelik Görüşlerinin Dağılımı (n=43) Tablo 2’de öğrencilerin sağlık sektöründe halkla ilişkiler ve iletişimin önemine yönelik görüşlerinin dağılımı yer almaktadır. Bulgular incelendiğinde; öğrencilerin %93,0’ı sağlık sektöründe halkla ilişkilerin önemli olduğunu düşünmekle birlikte, sağlık sektöründe halkla ilişkilere yeterince önem verildiğini düşünenlerin oranı %4,7 olarak belirlenmektedir. Öğrencilerin %100,0’ı sağlık sektöründe iletişimin önemli olduğunu ifade ederken, %51,2’si ise bu sektörde iletişime yeterince önem verilmediğine dikkat çekmektedir. Tablo 3: Öğrencilerin Sağlık Sektöründe Kullanılan İletişim Kanallarının Etkinliğine Yönelik Görüşlerinin Dağılımı (n=43) Tablo 3’de öğrencilerin sağlık sektöründe kullanılan iletişim kanallarının etkinliğine yönelik görüşlerine yer verilmiştir. Buna göre öğrencilerin %97,7’si hastalarla, %44,2’si personelle, %62,8’i de üstlerle kurulacak olan iletişimde yüz yüze iletişimin daha etkin olacağına işaret etmiştir. Tablo 4: Öğrencilerin Hastaların Beklentilerini Öğrenmede Etkili Olan Yöntemin Belirlenmesine Yönelik Görüşlerinin Dağılımı (n=43) Öğrencilerin hastaların beklentilerini öğrenmede etkili olan yöntemin belirlenmesine yönelik görüşlerinin dağılımına bakıldığında ise; en etkili yöntem olarak %53,5 ile hasta memnuniyeti araştırmalarının ön plana çıktığı, bunu %20,9 ile 7 HASTALARIN BEKLENTİLERİNİ ÖĞRENMEDE ETKİLİ OLAN YÖNTEMSayıSayı% Dilek ve istek kutuları614,0 Hasta memnuniyeti araştırmaları232353,5 Yazılı dilekçelerYazılı dilekçeler37,07,0 Hasta tarafından yapılan sözel istekler920,9 Hasta hakları biriminin aktif çalışması24,64,6 Toplam ,0100,0 DEĞİŞKENLERSayıSayı% Hastalarla Kurulacak Olan İletişim Yüz yüze iletişim424297,7 Yazılı iletişim12,32,3 Personel Arasında Kurulacak Olan İletişim Yüz yüze iletişim191944,2 Telefonla iletişim614,0 Yazılı iletişim24,64,6 Toplantı161637,2 Üstlerle Kurulacak Olan İletişim Yüz yüze iletişim272762,8 Yazılı iletişim511,6 Toplantı125,6 Toplam ,0100,0 DEĞİŞKENLERSayıSayı% Sağlık Sektöründe Halkla İlişkilerin Önemli Olduğunu Düşünenler EvetEvet404093,0 HayırHayır37,07,0 Sağlık Sektöründe Halkla İlişkilere Önem Verildiğini Düşünenler EvetEvet24,74,7 HayırHayır252558,1 KararsızKararsız161637,2 Sağlık Sektöründe İletişimin Önemli Olduğunu Düşünenler EvetEvet ,0100,0 Sağlık Sektöründe İletişime Önem Verildiğini Düşünenler EvetEvet511,6 HayırHayır251,2 KararsızKararsız161637,2 Toplam ,0100,0 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Sinem SOMUNO Ğ LU ve ark.

8 hasta tarafından yapılan sözel isteklerin izlediği, üçüncü olarak da %14,0 ile dilek ve istek kutularının geldiği görülmektedir. Tablo 5: Öğrencilerin Sağlık Sektöründe Halkla İlişkiler Faaliyetlerinde En Çok Sorun Yaşanan Sürece Yönelik Görüşlerinin Dağılımı (n=43) Tablo 5’de öğrencilerin sağlık sektöründe halkla ilişkiler faaliyetlerinde en çok sorun yaşanan sürece yönelik görüşlerinin dağılımı yer almaktadır. Buna göre öğrencilerin %37,2’si hasta kabulde, %18,6’sı muayene ve teşhis aşamasında, %16,2’si de hastalar tarafından yapılan sözel isteklerin iletilmesi sırasında sorun yaşandığına dikkat çekmektedir. Tablo 6: Öğrencilerin Sağlık Sektöründe Karşılaşılan İletişim Engellerine Yönelik Görüşlerinin Dağılımı (n=43) Tablo 6’da öğrencilerin sağlık sektöründe karşılaşılan iletişim engellerinin neler olduğuna yönelik görüşlerinin dağılımına bakıldığında; mesajın yeterince açık verilmemesinin (%44,2), alıcının iyi dinleme becerisine sahip olmamasının (%23,3) ve alıcının önyargılı davranmasının (%11,6) başlıca iletişim engelleri arasında yer aldığı görülmektedir. Tablo 7:Öğrencilerin Sağlık Sektöründe İletişim ve Halkla İlişkiler Alanında Yaşanan Sorunların Çözümüne İlişkin Önerilerinin Dağılımı (n=43) Tablo 7’de öğrencilerin sağlık sektöründe iletişim ve halkla ilişkiler alanında yaşanan sorunların çözümüne ilişkin önerilerinin dağılımı yer almaktadır (4). Buna göre öğrencilerin %41,9’u gerek çalışanlar gerekse hastalar arasında iletişimin geliştirilmesine yönelik girişimlerde bulunulmasının, %23,2’si halkla ilişkiler ve iletişim konusunda çalışma yapan uzman personelin artmasının, %20,9’u da iletişim sorunlarının kaldırılması için önlemler alınmasının gerekliliğine dikkat çekmiştir. 8 ÖNERİLERSayıSayı% İletişim sorunlarının ortadan kaldırılması için önlemlerin alınması920,9 Çalışanlar ve hastalar arasında iletişimin geliştirilmesine yönelik girişimlerde bulunulması181841,9 Halkla ilişkiler ve iletişim konularında çalışma yapan kişilerin uzmanlaşması101023,2 Etkili iletişim için halkın eğitimine önem verilmesi37,07,0 Hastaları anlayabilmek için empati yapılması37,07,0 Toplam ,0100,0 İLETİŞİM ENGELLERİNE YÖNELİK GÖRÜŞLERSayıSayı% Kaynağın alıcıyı iyi tanımaması49,39,3 Mesajın yeterince açık verilmemesi191944,2 Alıcının önyargılı davranması511,6 Alıcının iyi dinleme becerisine sahip olmaması101023,3 Alıcının konuya ilgisiz olması24,74,7 Tümü37,07,0 Toplam ,0100,0 EN ÇOK SORUN YAŞANAN SÜRECE YÖNELİK GÖRÜŞLERSayıSayı% Muayene ve teşhis aşamasında818,6 Kliniklerde37,07,0 AcildeAcilde614,0 Hastalar tarafından yapılan sözel istekler sırasında716,2 Hasta kabulde161637,2 Tüm süreçlerdeTüm süreçlerde37,07,0 Toplam ,0100,0 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Sinem SOMUNO Ğ LU ve ark.

9 TARTIŞMA Araştırmanın bulguları incelendiğinde; öğrencilerin sağlık sektöründe hem halkla ilişkilerin hem de iletişimin önemli olduğunu düşündükleri, ancak mevcut uygulamalar açısından her iki konuya da yeterince ortadan kaldırılması sürecine katkı sağlayacağını düşündüklerini de belirtmişlerdir. Yurdakul ve ark. tarafından yapılan araştırmanın bulgularına bakıldığında da; halkla ilişkiler alanında yapılan çalışmaların kurumun başarısını etkilediği ortaya çıkmaktadır (4). Bununla birlikte; hasta memnuniyetinin sağlanması, hastaların istek ve beklentilerinin karşılanması, iletişimin iyileştirilmesi, çalışanların personele yönelik davranışlarının incelenmesi, yüz yüze görüşmelerin yapılması vb. faaliyetlerin de halkla ilişkiler birimleri tarafından yürütülen önemli faaliyetler arasında sayılacağına ilişkin bulgulara ulaşılmıştır. önemönemverilmediğinoktasındabirleştikleri görülmektedir. Yurdakul ve ark. tarafından İzmir’de 5 ayrı özel hastanede yapılan bir çalışmaya göre de; çalışanların, sağlık sektöründe iletişime verilen önemin giderek arttığını düşündükleri ve halkla ilişkileri önemli bir işletme işlevi olarak algıladıkları ortaya çıkmaktadır (4). Araştırma sonucunda ulaşılan bir diğer sonuç da; öğrencilerin, hastalar, personel ve üstlerle kurulacak olan iletişimde en etkili iletişim yöntemi olarak yüz yüze iletişim yöntemini benimsedikleri ve hastaların beklentilerinin belirlenmesinde de hasta memnuniyeti araştırmalarının etkili olacağına inandıkları yönündedir. SONUÇ Araştırma sonucunda elde edilen bulgular çerçevesinde, sağlık sektöründe hedef kitlenin beklentilerinin karşılanması, sağlık davranışlarında istendik ölçüde davranış değişikliğinin yaratılması, sağlık bakım kalitesinin yükseltilmesi ve halkla ilişkiler ile iletişim faaliyetlerinin kendinden beklenen faydayı sağlaması Öğrencilermesajların yeterinceaçıkolarak verilmemesini bir iletişim engeli olarak gördüklerini ifade etmişlerdir. Bununla birlikte öğrenciler, iletişimin geliştirilmesine yönelik olarak alınacak önlemlerin, vb.vb.amaçlarıngerçekleştirilmesigerektiği düşünüldüğünde, aşağıdaki önerilerin geliştirilmesinin uygun olacağı öngörülmektedir. Buna göre; çalışanlar  ve hastalar arasında yaşanan sorunların Halkla ilişkiler çalışmalarına ve iletişim uygulamalarına gereken önem verilmeli, gerek hastaların gerekse çalışanların beklentileri değerlendirilmeli ve bu çerçevede beklentilerin karşılanması na yönelik gereken önlemler alınmalı, iletişimin önündeki engellerin ortadan kaldırılmasına yönelik düzenlemeler yapılmalı, halkla ilişkiler ve iletişim konularında uzman olan çalışanların uygulamalarından yararlanılmalı, çalışanların empati yeteneği geliştirilmeli, hasta ile kurulacak olan iletişimde anlaşılacak bir dil kullanılmasına özen gösterilmeli, yüksek düzeyde tıbbi terminoloji kullanmaktan kaçınılmalı ve çalışanlar ve hastalar konu ile ilgili olarak bilinçlendirilmelidir.  9 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Sinem SOMUNO Ğ LU ve ark.

10 KAYNAKLAR 1. Tengilimoğlu, D. (2001). Sağlık Kuruluşlarında Halkla İlişkiler. Gazi Kitabevi, Ankara, Sever, S. Dil ve iletişim (etkili yazılı ve sözlü anlatım) dergiler.ankara.edu.tr/dergiler/40/482/5655.pdf (Son Erişim: 20 Eylül 2012). 6. Yılmaz, E. (1996). Kütüphanecilikte halkla ilişkiler ve kitle iletişim araçları. Yayımlanmamış Yüksek Lisans Tezi, Hacettepe Üniversitesi Sosyal Bilimler Enstitüsü, Ankara, Mıhçıoğlu,C.C.Halkla ilişkiler nedir? dergiler.ankara.edu.tr/dergiler/40/487/5710.pdf (Son Erişim: 18 Eylül 2012). 7. Etkili İletişim 09.pdf (Son Erişim:08 Kasım 2012). 3. Alikılıç, Ö., Onat F. (2007). Bir halkla ilişkiler aracı olarak kurumsal bloglar. Journal of Yaşar University, 2(8): Erbaydar, T. (2003). Halk sağlığı açısından sağlık iletişimi. C.Ü. Tıp Fakültesi Dergisi, 25(4): Yurdakul, N.B., Coşkun, G., Öksüz, B. (2007). Hastanelerde halkla ilişkiler: izmir ili özel hastaneler örnekleminde halkla ilişkiler birimlerinin yapı-işlev ve uygulamalarına yönelik bir araştırma, Eskişehir Osmangazi Üniversitesi İİBF Dergisi, 2(1): Yazışma adresi: Sinem SOMUNOĞLU Uludağ Üniversitesi Sağlık Hizmetleri Meslek Yüksekokulu, Görükle Kampusu, Nilüfer/ BURSA. 10 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Sinem SOMUNO Ğ LU ve ark.

11 Aslı ÇETİN 1, Nigar VARDI 1, Doğan ORMAN 1 1 İnönü Üniversitesi Tıp Fakültesi, Histoloji ve Embriyoloji Anabilim Dalı, Malatya Amaç: Bu çalışma, Streptozotosin ile deneysel diyabet oluşturulan sıçanlarda kalp dokusunda meydana gelen histolojik değişiklikler üzerine aminoguanidinin olası iyileştirici etkilerinin gösterilmesi amacıyla planlandı. Materyal- Metod: Çalışmada 32 adet Sprague Dawley erkek sıçan kullanıldı. Deneyde kullanılan sıçanlar her bir grupta 8 adet olacak şekilde 4 gruba ayrıldı. Gruplar sırası ile Kontrol, Aminoguanidin, Diyabet ve Diyabet + Aminoguanidin olarak belirlendi. Deneysel diyabet, tek doz Streptozotosin’ in intraperitoneal uygulanması ile oluşturuldu. Hematoksilen- Eozin, Masson Trikrom ve Toluidin Blue ile boyanan kesitler, Leica DFC 280 ışık mikroskobu ve Leica Q Win Plus analiz sistemi kullanılarak incelendi. Bulgular: Kontrol ve Aminoguanidin grubunda kalp kası normal histolojik görünümde izlendi. Diğer yandan diyabet grubunda kalp kası hücrelerinde myofibril kaybı, eozinofilik sitoplazmalı ve piknotik nükleuslu hücreler, intrasitoplazmik vakuolizasyon ve konjesyon gözlendi. Ayrıca bu grupta Masson trikrom boyama metoduyla kas lifleri arasındaki kollajen lif yoğunluğunun ve kardiyak dokudaki toluidin blue boyama metoduyla mast hücrelerinin sayısının kontrol grubuna göre istatistiksel olarak önemli derecede arttığı tespit edildi. Aminoguanidin ile tedavi edilen grupta ise diyabetin neden olduğu myosit hasarında belirgin derecede azalma gözlendi. Diyabet grubunda izlenen kollajen lif yoğunluğundaki ve mast hücre sayısındaki artışın da bu grupta istatistiksel olarak önemli derecede azaldığı saptandı. Sonuç: Sonuç olarak bu çalışma, Streptozotosin ile deneysel diyabet oluşturulmuş sıçanların kalp dokusunda oluşan mikroskobik hasarın selektif nitrik inhibisyonu yapan ve antioksidan özellikleri bilinen aminoguanidin uygulaması ile azaldığını göstermektedir. Anahtar kelimeler: Aminoguanidin, diabet, kalp, sıçan, Streptozotosin. AMELIORATING EFFECTS OF AMINOGUANIDINE AGAINST IN THE HISTOLOGICAL ALTERATIONS OF RAT HEART IN EXPERIMENTAL DIABETES Objective: This study was planned to investigate beneficial effects of aminoguanidine on heart tissues of Streptozotocin - induced diabetic rats. Materials and Methods: 32 male Sprague Dawley rats were divided into 4 groups. Groups: Control, Aminoguanidine (1 gr/l in water for 10 weeks), Diabetes and, Diabetes + Aminoguanidine. The animals in group diyabet and diyabetes + aminoguanidine were made diabetic by intraperitoneal injection of Streptozotocin. At the end of the study, hearts were removed. The tissue samples were fixed in 10% formalin, were processed by tissue preperation techniques and were embedded in paraffin. Tissue blocks were sectioned at a thickness of 4 µm mounted on slides stained with The sections were stained with Hematoxylen- Eosin, Masson’s Trichrome and Toluidine Blue and examined under a Leica DFC280 light microscope by Leica Q Win and Image Analysis System (Leica Micros Imaging Solutions Ltd.; Cambridge, U.K). Results: The heart muscle sections from control and aminoguanidine groups were normal histological appearence. On the other hand we observed myofibril loss in cardiac muscle cells, eosinophilic cytoplasm and pyknotic nuclei cells, intracytoplasmic vacuolization and congestion in Diabetes group. In addition to this, we detected increase of density of collagen fibers between muscle fibers of the cardiac tissue and the number of mast cells stained with toluidine blue were significantly increased in diabetes group than control group. In aminoguanidine treated group, myosit damage caused by diabetes was significantly reduced. The density of collagen fibers and the increase in the number of mast cells observed in Diabetes group were significantly decreased in this group as statistical analysis. Conclusion: In conclusion, we observed decrease of microscopic damage of heart tissue in Streptozotocin induced diabetic rats with the application of aminoguanidine is known that inhibition of nitric oxide and antioxidant properties. Key Words: Aminoguanidine, diabetes, heart, rat, Streptozotocin. 11 DENEYSEL DİYABETİN SIÇAN KALP DOKUSUNDA MEYDANA GETİRDİĞİ HİSTOLOJİK DEĞİŞİKLİKLER ÜZERİNE AMİNOGUANİDİNİN İYİLEŞTİRİCİ ETKİLERİ SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

12 DENEYSEL DOKUSUNDA HİSTOLOJİK DİYABETİN SIÇANKALP radikalleri süpürücü etkisi ile de antioksidan özellikleri MEYDANA GETİRDİĞİ olduğu bildirilmiştir (6, 8). DEĞİŞİKLİKLERÜZERİNEÜZERİNE Bu çalışmada, streptozotosin (STZ) ile deneysel diyabet AMİNOGUANİDİNİN İYİLEŞTİRİCİ ETKİLERİ Diyabet, pankreasın insülin salgısında azalma ya da oluşturulan sıçanlarda kalp dokusunda meydana gelen etkisindeki yetersizlik sonucu oluşan ve hiperglisemi ilehistolojik değişiklikler üzerine aminoguanidinin olası kendini gösteren metabolik bir hastalıktır (1). Diyabetiyileştiricietkilerinin histolojikyöntemlerle damar, böbrek ve göz gibi organizmanın çeşitliaraştırılması amaçlanmıştır. organlarını etkileyen komplikasyonların gelişiminde GEREÇ VE YÖNTEMLER önemli rol oynamaktadır. Diyabetle ilgili morbidite veÇalışmada İnönü Üniversitesi Tıp Fakültesi Deney mortaliye yol açan nedenlerden biri de kardiyovaskülerHayvanları Araştırma Merkezinden temin edilen komplikasyonlardır (2). Yapılan klinik ve deneyselSprauge- Dawley cinsi, ağırlıkları gr arasında çalışmalar, diyabetin miyokardiyal disfonksiyon,32 adet erkek sıçan kullanıldı. Deneyde kullanılan ventriküler dilatasyon (3) ve koroner ateroskleroz gibisıçanlar her bir grupta 8 adet olacak şekilde 4 gruba kardiyak bozukluklara neden olduğunu göstermiştirayrıldı. Gruplar sırası ile; Kontrol, Aminoguanidin (4,5). Diyabetin neden olduğu kardiyomyopatinin(AG), Diyabet (D) ve Diyabet + Aminoguanidin patogenezisi henüz kesin olarak tanımlanamadığı için(D+AG) olarak belirlendi. diyabetik kalp hastalıklarının önlenmesinde veDiyabet oluşturulacak D ve DAG grubundaki sıçanlara tedavisinde spesifik bir ilaç geliştirilememiştir (3). Son450 mg Streptozotosin (STZ) (Sigma, USA), 10 cc yıllarda diyabetin neden olduğu komplikasyonlarındistile su içerisinde çözülerek (45 mg/kg tek doz), gelişmesinde en önemli neden olarak oksidatif streshayvan ağırlıklarına göre intraperitonal (i.p) olarak gösterilmektedir. Sağlıklı bireylerde antioksidanlar veenjekte edildi. D ve DAG gruplarına uygulanan STZ serbest radikaller arasında bir denge bulunmaktadır.enjeksiyonundan 72 saat sonra tekrar kan alınıp, (Accu Hiperglisemide glukoz ototoksikasyonu ve proteinChek Glukometre - Roche) glukometreyle kan glikoz glikozilasyonu ile serbest radikallerin oluşum hızınınseviyeleri ölçüldü. Kan glikoz seviyeleri 270 mg/dL ve artması bu dengeyi bozarak oksidatif strese nedenüzerinde olanlar çalışmaya dahil edildi. AG, sıçanlara olmaktadır (6).çeşme suyu içerisinde 1 gr/L doz oranında, iyice Bir phenyl hidrazine bileşiği olan aminoguanidin (AG)çözülerek hazırlandı ve her gün aynı saatte deneklere inducible nitrik oksit sentezi (İnos)’ni selektif olarakverildi. 10 haftalık deney süresinde; tüm hayvanlar inhibe ederek nitrik oksit (NO) üretimini azaltır (7).standart sıçan yemi ve AG verilen gruplar dışındakiler Ayrıca non enzimatik glikozilasyon bölgelerinenormal içme suyu aldılar. Sıçanların günlük içme suyu bağlanan daimin oksidazı inhibe eder ve reaktif karboniltüketimleri mezur ile ölçülüp, her sıçanın bir günde parçalarını yakalayarak daha ileri glikozilasyontükettiği ortalama AG miktarı mg olarak hesaplandı. ürünlerininin oluşumunu önler. Bunlara ek olarakDeney süresi sonunda ketamin/ksilazin anestezisi yapılan bazı çalışmalarda AG’ ın peroksinitrit gibialtında sıçanların kalp dokuları alınarak %10’luk formaldehit içerisinde tespit edildi. Alınan doku 12 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

13 örnekleri rutin doku takip işlemlerinden geçirildi veToluidin Blue boyama yöntemleri uygulandı. parafine gömüldü. Elde edilen bloklardan mikrotomlaHazırlanan preparatlar Leica DFC 280 ışık mikroskobu (Leica RM 2245) 4 µm kalınlığında kesitler alındı.ve Leica Q Win Plus analiz sistemi kullanılarak Kesitlere Hematoksilen- Eozin, Masson Trikrom veincelendi. HİSTOLOJİK DEĞERLENDİRME: Kesitler histolojik olarak; kalp kasında miyofibril kaybı, İSTATİSTİKSEL DEĞERLENDİRME: intrasitoplazmik vakuolizasyon, eozinofilik boyanmışİstatistiksel değerlendirmeler SPSS 13.0 programı ile ve piknotik nükleuslu hücreler ve konjesyon açısındanKruskal Wallis Varyans Analizi ve Mann Whitney –U incelendi. Histolojik değerlendirme için hazırlanantesti kullanılarak yapıldı. Grup içindeki değişim testi ise preparatlardan X20’likbüyütmede1010alanalanWilcoxon eşleştirilmiş iki örnek testi ile yapıldı. Tüm değerlendirildi.Değişiklikler, histolojik hasarın sonuçlar ortalama  standart hata olarak ifade edildi ve şiddetine göre yok 0, hafif 1, orta 2 ve şiddetli 3 olarak P<0.05 istatistiksel olarak anlamlı bulundu. skorlandı. Maksimum skor 12 olarak belirlendi. Her bir BULGULAR KAN GLİKOZ DEĞERLERİ grubun skorlaması yapıldı ve her grup için ortalama DiyabetDiyabet(D)(D)grubundakisıçanlardaSTZSTZ değerler saptandı. Toluidin blue ile boyanan enjeksiyonundan (72 saat sonra) deneyin sonuna kadar preparatlarda, X40 büyütmede rastgele 10 alanda mast hiperglisemi gözlendi. Diğer yandan D+AG grubunda, hücreleri sayılıp, ortalamaları alındı ve istatistiksel D grubuna göre başlangıç- sonuç kan glikoz seviyeleri açıdan değerlendirildi.Masson trikrom ile boyanan farkı açısından istatistiksel olarak anlamlı bir azalma preparatlar fibrozis yönünden değerlendirildi (0: saptandı (P=0.001). Sıçanların deneyin başlangıç ve fibrozis yok, 1: kesitteki alanın %25'inden azında sonundaki kan glikoz değerleri Tablo I’de verildi fibrozis var, 2: kesitteki alanın %25- 50'sinde fibrozis var, 3: kesitteki alanın %50'sinden fazlasında fibrozis var). Tablo I: Grupların başlangıç-sonuç kan-glikoz değerleri. Not: K: Kontrol grubu, AG: Aminoguanidin grubu, D: Diyabet grubu, DAG: AG verilmiş diyabet grubu. n: Sıçan sayısı ♦: Ba şlangıç -sonuç farkları FY: Fark yok. 13 GRUPLAR PARAMETRELERK (n=8)AG (n=8)D (n=8)DAG Başlangıç kan-glikoz (mg/d128.6± ±6383.3± ±6.1 Final kan-glikoz (mg/dl)154.4± ± ± ±7.8 Kan-glikoz farkları (mg/dl) ♦ 25.7± ± ± ±8.5 P Değerleri GRUPLARKAN- GLUKOZ FARKLARI K-D0,001 K- DAG  0,05 (FY) D- DAG0,001 AG- DAG  0,05 (FY) SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

14 HİSTOLOJİK BULGULAR: kollajen liflerin yoğunluğunun kontrol grubuna göre Kontrol ve Aminoguanidin Grupları: arttığı gözlendi (1,54 ± 0,83)(Resim 4A). Toluidin blue Kontrol grubunun kalp kası normalhistolojikboyama metoduyla mavi-mor renkte boyanan görünümde izlendi (Resim 1A). Aminoguanidin verilengranülleriyle ayırt edilen mast hücrelerinin sayısı grupta da kalp kası (Resim 1B) kontrol grubuna benzerkontrol grubuna göre istatistiksel olarak önemli özellikler göstermekteydi. Kontrol grubunda (Resimderecede artmıştı (2,69 ± 1,34)(Resim 4C) (p<0.0001). 1C) mast hücre sayısı 1,09 ± 1,15, aminoguanidin Diyabet + Aminoguanidin Grubu: grubunda (Resim 1D) ise 1,20 ± 1,04 olarak tespitAminoguanidin ile tedavi edilen grupta eozinofilik edildi.boyanmış ve piknotik nükleuslu hücrelerin diyabet Diyabet Grubu: grubuna göre azaldığı gözlendi (Resim 3A). Diyabet oluşturulan grupta bazı kalp kası hücrelerindeİntrasitoplazmik vakuoller de nadir olarak izlendi belirgin myofibril kaybı olduğu gözlendi (Resim 2A).(Resim 3B). Masson Trikrom boyama metodu ile Ayrıca diyabetik sıçanların kesitlerinde normal kalpboyanmış preparatlarda, kollajen lif yoğunluğunun kası dokusundan, yoğun asidofil sitoplazması ve(1,04 ± 0,77) diyabet grubuna göre istatistiksel olarak piknotik nükleusları ile ayırt edilen kas hücre gruplarıönemli derecede azaldığı tespit edildi (Resim 4B). izlendi (Resim 2B). Bazı kas liflerinde farklıToluidin blue boyama metodu ile boyanmış kesitlerde büyüklüklerde izlenen intrasitoplazmik vakuoller dikkatortalama mast hücre sayısı (1,67 ± 1,28) diyabet çekiciydi (Resim 2B, 2C). Diğer bir bulgu konjesyongrubuna göre istatistiksel olarak anlamlı derecede olarak değerlendirilen eritrositlerle dolu venlerinazalmıştı (Resim 4D) (p<0,0001). Grupların histolojik izlenmesiydi (Resim 2D). Masson trikrom boyamaskor, fibrozis ve mast hücre sayıları Tablo 2’ de verildi. metoduyla kas lifleri arasında yeşil olarak boyanan Tablo 2: Grupların semiquantatif olarak histolojik değerlendirilmesi 14 GruplarKollajen lif yoğunluğuMast hücre sayısıHistolojik 1- Kontrol0,36 ± 0,581,09 ± 1,150,08 ± 0,27 2- AMG0,44 ± 0,601,20 ± 1,042,16 ± 1,06 3- DM1,54 ± 0,832,69 ± 1,346,53 ± 1,28 4- DM+ AG1,04 ± 0,771,67 ± 1,283,86 ± 1,333,86 ± 1,33 p<0, ,41-3,41-3,41-3,41-3,41-3,4 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

15 HİSTOLOJİK BULGULAR: Resim 1: Kontrol ve AG grubu: (A, B) Kalp kasının normal histolojik görünümü, Masson trikromX40; (C,D) Mast hücreleri (oklar), Toluidin blue X SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

16 Resim 2: Diyabet grubu: (A) Kalp kası hücrelerinde myofibril kaybı H- X40 ;(B) eozinofilik boyanmış ve piknotik nükleuslu hücreler (oklar) H-E X20; (C) intrasitoplazmik vakuolizasyon (oklar) H-E X40; (D) konjesyon (oklar) H-E X20. Resim 3: D+AG grubu: (A) eozinofilik ve piknotik nükleuslu hücreler (beyaz oklar) ve intrasitoplazmik vakuolizasyon (siyah ok lar) D grubuna göre daha az gözlenmekte H-EX20, (B) D grubuna göre myofibril kaybında ve konjesyonda azalma (oklar) H-EX SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

17 Resim 4: D ve D+AG grubu: D grubunda (A) kollajen lif yoğunluğunun D+AG (B) grubuna göre artt şı, Masson trikrom X20. D+AG grubunda (D) Streptozotosin, pankreasta serbest radikal temizleyicisi TARTIŞMA Bu çalışmada; deneysel diyabet oluşturulan sıçanlarınolan superoksit dismutazı inhibe eder ve böylece serbest kalp kasında meydana gelen hasar üzerine radikallerin birikmesi sonucu β h ücreleri yıkıma uğrar. aminoguanidinin tedavi edici özellikleri histokimyasal(11). Çalışmada STZ enjeksiyonunun 3. gününden yöntemlerle araştırıldı.deneyin sonuna kadar, D grubunda hiperglisemi izlendi. Çalışmalarda sıçanlarda diyabet modeli oluşturmak içinAG ile tedavi edilen grupta ise, kan-glikoz değerleri D Streptomyces achromogenes tarafından üretilen birgrubuna göre anlamlı olarak azalmıstı. Bu sonuçlar, antibiyotik olan STZ ortalama mg ve tek dozdiyabetik sıçanlara uygulanan 8 haftalık AG tedavisinin olarak kullanılmaktadır. (6, 9, 10). Biz de çalışmamızdaplazma glikoz seviyeleri üzerinde anlamlı bir azalmaya STZ’yi 45 mg/kg ve tek doz olarak uyguladık. 17 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

18 neden oldugunu bildiren Liptowa ve Vardı ilehomeostazını sürdürmede yetersiz kaldığı durumlarda uyumludur (6).ortaya çıkmaktadır (17). Okruhlicova L ve ark. STZ kullanılarak oluşturulan deneysel diyabetdiyabetik erkek sıçanların myokardiyal hücre modellerinde, sıçanların kalp kası hücrelerindesitoplazmalarındavakuollerinşekillendiğiniveve myofibrillerde hasar, lipid birikimi ve çekirdektesarkoplazmik retikulumun azaldığını göstermişlerdir kromatin kondensasyonu gibi dejeneratif değişiklikler(20). Çalışmamızdaki diyabet oluşturulan grupta kalp olduğu bildirilmiştir (12-14). Harackova ve Murphy,kası hücrelerinde sitoplazma içerisinde irili ufaklı pek STZ ile oluşturulan diyabet modelinde sıçanlarda 8-10çok vakuol gördük. haftalık süreçte, ventriküler kalp kası hücrelerindeMast hücreleri, kalp dokusunda kalp kası hücreleri ile minimal düzeyde değişiklik olduğunu savunmuşlardıryakınındaki kan damarları arasında yerleşim (15). Cai ve ark mg/kg STZ enjeksiyonu ilegöstermektedir. Bunun yanı sıra mast hücreleri erkek sıçanlarda oluşturduğu diyabet modellerinde, 12koronerlerin adventisyasında da tespit edilmiştir (21). hafta sonunda miyokard tabakasındaincelmePatella ve ark. dilate ve iskemik kardiyomyopatilerde gözlemlemişlerdir (16).mast hücre sayısının arttığını bildirmektedir (22). Biz de Biz de çalışmamızda D grubunda kalpkasındaçalışmamızda toluidin blue ile boyanan preparatlarda eozinofilik sitoplazmalı ve piknotik nükleuslu hücreler,diyabet grubunda mast hücre sayısının kontrollere göre sarkoplazmadamiyofibrilkaybıkaybıgözlemledik.istatistiksel olarak arttığını saptadık. Mast hücrelerinin Eozinofilik sitoplazmalı myokardiyal hücrelerinkardiyak fibroblastları stimüle ederek kollajen üretimini koagülasyon nekrozuna giden hücreler olduğuarttırdığı bildirilmektedir (23). Ayrıca mast hücreleri gösterilmiştir. Bu tip hücreler, genelde iskemi ya da kimaz, TGF-β salgılayarak ve anjiotensin II’yi artırarak kimyasal hasar gibi stresler sonucu ortaya çıkmaktadırfibroziste etkili olmaktadır. Bahçeci ve ark. diyabetin ve nekrozun kalp kasındaki erken bulguları olarakakut dönemde kalp kası hücrelerinde minimal düzeyde değerlendirilmektedir (17). Hücre içi pH seviyesininfibrozise neden olduğunu ve kalp dokusunun hastalığın düşmesi ve hücrenin asidoza gitmesi sonucu çeşitlierken dönemlerinden itibaren etkilenmeye başladığını enzimleri aktive olmaktadır. Aktive olan enzimleringöstermişlerdir (24). Bizim çalışmamızda da diyabetik yapısal ve enzimatik sitoplazma proteinlerini denatüresıçanların kalplerinde kollajen lif yoğunluğu belirgin etmesi sonucu, ortama verilen bazik gruplar, asitderecede artmıştı.derecede artmıştı. boyalara (eozin) affinite göstererek sitoplazmanınÇalışmamızda AG verilmesinin, deneysel diyabet asidofilik boyanmasına neden olmaktadırlar (17).oluşturulan sıçanların kalp kasında görülen myofibril Diyabette myokardiyal hücre ölümünün mekanizmasıkaybını, eozinofilik boyanmış ve piknotik nükleuslu ile ilgili yapılan çalışmalarda oksidatif stresin (18)hücrelerinhücrelerinyoğunluğunuveveintrasitoplazmik önemli bir rol oynadığı bildirilmiştir. Hücrenin stresevakuolizasyonun şiddetini azalttığı izlendi. karşı verdiği ilk yanıt intrasitoplazmik vakuollerleYüksek glukoz seviyelerinin neden olduğu myosit karakterize hidropik değişikliklerdir (17, 19). HücrenekrozunakarşıAG’ninkoruyucuetkileri membran permeabilitesinin bozulduğu, iyon ve sıvıgösterilmiştir. AG, reaktif bir oksidan olan peroksinitriti 18 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

19 (ONOO-) ve hidrojen peroksit (H2O2) türevi hidroksilbildirmişlerdir. Kardiyak fibrozis kollajen fibrillerin radikallerini (OH-) direk süpürücü etkiye sahiptir.artması ve kontraktil fonksiyonun azalması ile Böylece hücre içerisindeki oksidan düzeylerinikarakterizedir. Yapılan çalışmalarda diyabette izlenen azaltmakta ve kardiyak myositleri, STZ’ye bağlı olarakkalp dokusundaki kollajen birikiminde metalloproteaz 2 ortaya çıkan oksidatif strese karşı korumaktadır (25,ve 9’un önemli rol oynadığı gösterilmektedir (29-31). 26). AG’nin diyabetik kalp hasarına karşı iyileştiriciAG’nin anti fibrotik etkisinin de muhtemelen etki mekanizmalarından biride selektif bir İnosmetalloproteaz 2 ve 9’un aktivitesini değiştirmesine inhibitörü olmasıdır. Ag, İnos inhibisyonuyla vaskülerbağlı olduğu düşünülmektedir (25). permeabiliteyi düzenlemektedir (26). Adams ve ark.,Diğer yandan, yüksek glikozun neden olduğu serbest NOS izoformlarını inhibe ettikleri çalışmalarında,radikallerin ve inflamatuar sitokinlerin, kardiyak selektif bir iNOS inhibitörü olan AG’nin non-selektiffibroblastlardankollajenüretiminiüretiminiarttırdığı eNOS inhibitörü L-NAME ile tedavi edilen gruplarabildirilmektedir. AG, serbest radikalleri süpürücü etkisi göre miyokardiyal fonksiyonları daha anlamlı birile de oksidatif strese bağlı olarak gelişen kollajen şekilde iyileştirdiğini göstermiştir (27).üretimini inhibe etmiş olabilir (25). Ayrıca kollajen lif yoğunluğunun da D+AG grubunda DSonuç olarak bu çalışma, STZ ile deneysel diyabet grubuna göre istatistiksel olarak önemli derecedeoluşturulmuş sıçanların kalp dokusunda oluşan azaldığı gözlendi. Güçlü bir antioksidan olan AG’ninhasarların, antioksidan etkisi olduğu bilinen AG diyabette olası komplikasyonlara karşı yararlı etkileriuygulaması ile azaldığını göstermektedir. AG’nın tedavi olduğu farklı hayvan modellerinde gösterilmiştir (28).edici mekanizmasını anlamak için daha ileri çalışmalara Vadla GP ve ark. (25) 100 mg/kg STZ verilen farelerinveveklinikdenemelerindenemelerinyapılmasınaihtiyaç kalp dokusundaizlenenizlenenkollajen birikiminin AGduyulmaktadır. uygulamasıylaönemliönemliderecedederecedeazaldığını 19 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

20 KAYNAKLAR: 16- Cai F. Studies of enzyme histochemistry and ultrastructure of the 1- Yenigün M, Altuntaş Y. Her Yönüyle Diabetes Mellitus, 2. Baskı.myocardium in rats with streptozotocin-induced diyabetes. Zhonghua Yi İstanbul: Nobel Tıp Kitapevleri; s Xue Za Zhi 1989; 69: Li Y, Ma J, Zhu H, Singh M, Hill D, Greer PA, Arnold JM, Abel ED,17- Cotran RS, Kumar V, Collins T. Robbins Pathologic Basis of Disease. Peng T. Targeted inhibition of calpain reduces myocardial hypertrophySaunders Company.1999; and fibrosis in mouse models of type 1 diabetes. Diabetes 2011 Nov18- Li Z, Zhang T, Dai H, et al. Involvement of endoplasmic reticulum ;60(11): stress in myocardial apoptosis of streptozocin-induced diabetic rats. J Clin 3- Guan SJ, Ma ZH, Wu YL, Zhang JP, Liang F, Weiss JW, Guo QY, WangBiochem Nutr. 2007;41(1): JY, Ji ES, Chu L. Long term administration of fasudil improves19- Wyllie A, Duvall E. Cell injury and death. In: Mc-Gee JOD, Isoocson cardiomyopathy in streptozotocin-induced diabetic rats. Food ChemPG, Wright NA ed(s).Oxford textbook of pathology. Oxford University Toxicol 2012 June; 50(6): Press, New York, 1992; Shaper LM, Howart AP, Calter MM. Left-ventricular function in20- Okruhlicova L, Sotnikova R, Stefek M et al. L-arginine reduces diabetes mellitus. I. Methodology and prevalance and spectrum ofstructural remodeling in the diabetic rat myocardium. Methods Find Exp abnormalities. Br Heart J 1981; 45: Clin Pharmacol. 2002; 24: Penpragkul S, Schaible T, Yipinstoi T et al. The effects of diabetes on21- Akgül A, Ünal O, Kervan Ü. Mast hücrelerinin kalp hastalıkları ve performance and metabolism of rat hearts. Circ Res 1980; 47: cerrahisindeki rolü. Türkiye Klinikleri J Med Sci 2011; 31(4). 6- Vardı N, Iraz M, Gül M, Öztürk F, Uçar M, Otlu A. Diyabetin22- Patella V, Marinò I, Arbustini E, Lamparter- Schummert B, Verga L, böbreklerde neden olduğu histolojik değişiklikler üzerine aminoguanidininAdt M, et al. Stem cell iyileştirici etkileri. Türkiye Klinikleri Tıp Bilimleri 2006; 26: factor in mast cells and increased mast cell density in idiopathic and 7- Polat A, Parlakpinar H, Taşdemir S, Çolak C, Vardi N, Uçar M, et al.ischemic cardiomyopathy. Protective role ofCirculation 1998;97: aminoguanidine on gentamicin-induced acute renal failure in rats. Acta23- de Almeida A, Mustin D, Forman MF, Brower GL, Janicki JS, histochemica 2006; 108: CarverW. Effects of mast cells 8- Ihm SH, Yoo HJ, Park SW, Ihm J. Effect of aminoguanidine on lipidon the behaviour of isolated heart fibroblasts: modulator of collagen peroxidation in streptozotocin induced diabetic rats. Metabolism 1999;remodeling and gene 48: expression. J Cell Physiol 2002;19: Vardı N, Iraz M, Öztürk F, Ucar M, Gül M, Eşrefoğlu M, Otlu A.24- Bahçeci S, Canoruç N, Nergis Y, Söker S, Gökalp D, Akbalık ME, Deneysel diyabetin sıçan böbreklerinde meydana getirdiği histolojikTutşi Y. Alloksan ile oluşturulan deneysel diyabetin kardiyo-vasküler değişiklikler üzerine melatoninin iyileştirici etkileri. İnönü Üniversitesi Tıpsistem üzerindeki akut etkilerinin ışık mikroskobik düzeyde incelenmesi. Fakültesi Dergisi, 2005;12(3): Dicle Tıp Dergisi 2007; 34(2): Öztürk F, Gül M, Ağkadir M, Yağmurca M. Deneysel diyabetin sıçan25- Vadla GP, Vellaichamy E. Anti fibrotic cardio protective efficacy of testislerinde meydana getirdiği histolojik değişiklikler. Türkiye Klinikleriaminoguanidine against streptozotocin induced cardiac fibrosis and high Tıp Bilimleri 2002;22: glucose induced collagen up regulation in cardiac fibroblasts. Chemico- 11- Endotel. İzmir Tabip Odası Tıpta Temel Bilimler Kolu SonbaharBiological Interactions 2012; 197: Okulu, Parlakpınar H, Örüm MH, Acet A. Aminoguanidin ve Kardiyovasküler 12-Zhu XX, Zhou XP, Zhong XL et al. Streptozotocin inducedSistem. İnönü Üniversitesi Sağlık Bilimleri Dergisi 2012; 2: -14. cardiomyopathy in diabetic rats. Chin Med J (Engl).1993; 106: Adams JA, Wu D, Bassuk J, et al. Nitric oxide synthase isoform 13- Seager MJ, Singal PK, Orchard R et al. Cardiac cell damage: ainhibition before whole body primary myocardial disease in streptozotocin – induced chronic diabetes.ischemia reperfusion in pigs: vital or protective? Resuscitation 2007; Br J Exp Path.1984; 65: (3): Cai F. Studies of enzyme histochemistry and ultrastructure of the28- Okamoto T, Okabe S. Inhibition of anti-Fas antibody- induced myocardium in rats with streptozotocininduced diabetes. Zhonghua Yi Xuehepatitis by aminoguanidine in mice. Eur J Pharmacol 2000; 403(3):277- Za Zhi.1989; 69: Harackova M, Murphy MG. Effects of chronic diabetes mellitus on the29- H. Li, H. Simon, T.M. Bocan, J.T. Peterson, MMP/TIMP expression in electrical and contractile activities, 45Ca2+ transport, fatty acid profilesspontaneously hypertensive heart failure rats: the effect of ACE- and and ultrastructure of isolated rat ventricular myocytes. Pflugers Arc 1988;MMPinhibition, Cardiovasc. Res. 2000; 46 (2): 298– : SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

21 30- S. Heymans, B. Schroen, P. Vermeersch, H. Milting, F. Gao, A.31- H.B. Kwak, J.H. Kim, K. Joshi, A. Yeh, D.A. Martinez, J.M. Lawler, Kassner, H. Gillijns, P. Herijgers, W. Flameng, P. Carmeliet, F. Van deExercise training reduces fibrosis and matrix metalloproteinase Werf, Y.M. Pinto, S. Janssens, Increased cardiac expression of tissuedysregulation in the aging rat heart, FASEB J. 2011;25(3) 1106–1117 inhibitor of metalloproteinase- 1 and tissue inhibitor of metalloproteinase- Yazışma adresi: Aslı ÇETİN İnönü Üniversitesi Tıp Fakültesi, Histoloji ve Embriyoloji Anabilim Dalı, Malatya 2 is related to cardiac fibrosis and dysfunction in the chronic pressure- overloaded human heart, Circulation 2005; 112(8):1136– SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Aslı ÇET İN ve ark.

22 Bayram KAHRAMAN 1, Cemal TAŞDEMİR 2, Caner EDİZ 2, Ayşegül KAHRAMAN 3, Ramazan ALTINTAŞ 2, Mustafa KANBAY 4 1 Özel Malatya Hastanesi, Radyoloji Bölümü, Malatya 2 İnönü Üniversitesi, Tıp Fakültesi, Üroloji Anabilim Dalı, Malatya 3 İnönü Üniversitesi, Tıp Fakültesi, Radyoloji Anabilim Dalı, Malatya 4 Malatya Devlet Hastanesi, Üroloji Bölümü, Malatya Özet: Anjiomyolipom, değişen oranlarda düz kas, displastik kan damarları ve yağ dokusundan oluşan en sık görülen benign mezenkimal böbrek tümörüdür. 4 cm’den küçük lezyonlar çoğunlukla bulgu vermez. 4 cm’den büyük lezyonlarda kanama riski artar ve lezyon semptomatik hale gelebilir. Burada, sol yan ağrısı şikayeti ile başvuran, hemorajik anjiomyolipom saptanan 46 yaşında kadın olgu sunulmaktadır. Anahtar kelimeler: Anjiomyolipom, semptom, konservatif tedavi, Abstract: Angiomyolipoma is the most common benign mesenchymal renal neoplasm, consisting of varying proportions of smooth muscle, dysplastic blood vessels, and adipose tissue. They are usually asymptomatic if the tumor size is less than 4 cm. In angiomyolipomas greater than 4 cm, there is an increased risk of hemorrage and patients may become symptomatic. Here, we report a case of renal hemorragic angiomyolipoma in a 46-year-old woman who presented to the our clinic with left flank pain.flank pain. Keywords: Angiomyolipoma, symptom, conservative treatment 22 RENAL RÜPTÜRE HEMORAJİK ANJİOMYOLİPOMLARDA KONSERVATİF YAKLAŞIM: OLGU SUNUMU SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Bayram KAHRAMAN ve ark.

23 GİRİŞ solid görünümde, böbrek korteksinde lokalize yağ Anjiomyolipomlar(AML)(AML)sıksıkgörülenrenaldansitesi ve hemoraji alanları içeren yer kaplayıcı hamartomlar olup içerisinde matür yağ doku, düz kas veoluşum ve sol böbrekte hafif pyeloektazi saptandı damar bulunduran benign tümörlerdir. Olguların büyük(Resim 1). Olgu, radyolojik olarak rüptüre hemorajik bir kısmı sporadik ve soliter olup genellikle deanjiyomiyolipom olarak değerlendirildi. Kitlenin asemptomatik lezyonlardır (1,2). AML’lerin % 40’ınatürünü ve kontrastlanma paternini göstermek için semptomatiktir. Palpe edilen abdominal kitle, hematüri,çekilen kontrastlı üst abdomen MRG sonucunda sol yan ağrısı gibi belirtiler gösterirler. Soliter sporadikböbrek orta kesim komşuluğundan dalak komşuluğuna tümörlerde tümör içine spontan kanama nedeniyle akutuzanan yaklaşık 8x5 cm boyutta, içerisinde ve böbrek karın tablosu ve şok gelişebilir (3). Bu yazıda, şiddetliorta kesimde T1A-T2A hiperintens yağ baskılı sekansta sol yan ağrısı şikayetiyle üroloji polikliniğimize gelenbaskılanan yağ dokusuna ait alanlar bulunan, yine bir renal hemorajik AML’li hastanın akut kanamasınınetrafında T1A hiperintens T2A hipointens rimi izlenen takibi ve tedavidekonservatifyaklaşımmodelimodelieleelesantrali T1A-T2A hafif hipointens hemorjik yer alınmıştır.kaplayıcı oluşum izlendi (Resim 2).Üroloji Servisine OLGUOLGU yatırılan hastaya Htc takibi ve konservatif tedavi Kırk altı yaşında kadın hasta, sol yan ağrısı şikayetiyleuygulandı. Hastanın yaklaşık 4 ay sonra çekilen kontrol üroloji polikliniğimize başvurdu. Hastanın ağrıları, sonabdomen bilgisayarlı tomografisinde sol böbrekte birkaç gün içerisinde giderek artan özellikteydi. Fiziklokalize rüptüre hemorajik AML boyutunun küçüldüğü muayenede sol kosto-vertebral açı hassasiyeti vardı.ve yaklaşık 3x2 cm olduğu görüldü (Resim 3). Tansiyon arteriyel 130/85 mmHg, ateş 37,2 0 C ölçüldü. Kanın biyokimyasal incelemesinde beyaz küre (Wbc) K/uL, hemoglobin (Hgb) 13 g/dL, hematokrit (Htc) %38 ve kreatinin 0,7 mg/dL ölçüldü. Diğer biyokimya değerleri ve idrar incelemesi normal sınırlardaydı. Hastanın abdomen ultrasonografi (USG) incelemesinde sol böbrek lateralinden başlayan ve Resim 1: Kontrastsız abdominal BT, sol böbrekte (a) yaklaşık 8x5 cm boyutta hiperdens heterojen solid görünümde (b) içinde böbrek korteksinde yerleşimli yağ dansitesi (c) ve hemoraji alanları içeren yer kaplayıcı oluşum süperiora dalak mediali ile sürrenal gland lojuna uzanan, hiperekoik heterojen, solid görünümde yaklaşık 8x5 cm ölçülerinde yer kaplayıcı lezyon saptandı. Radyolojik olarak, kitle ve hematom öntanısı ile ileri tetkik olarak kontrastsız abdominal bilgisayarlı tomografi (BT) ve kontrastlı üst abdomen manyetik rezonans görüntüleme (MRG) yapıldı. Kontrastsız abdominal tomografi incelemesinde USG’deki aynı lokalizasyonda ve aynı boyutlarda, hiperdens heterojen 23 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Bayram KAHRAMAN ve ark.

24 büyük olan hastaların %90’ ı semptomatiktir ve %50- 60’ ı herhangi bir zamanda kanayabilir (5). AML’de kanama sık görülür. Tümör büyüdükçe kanama riskleri artmaktadır. Ayrıca damar duvarı yapısının normal bir damardan daha kalın, fakat daha az esnek olmasından dolayı non travmatik durumlarda kanamaya olan yatkınlığı, normal bir damardan daha Resim 2: Kontrastlı üst abdomen MRG, sol böbrek orta kısımda (a) 8x5 cm boyutta, içerisinde T1A-T2A hiperintens yağ baskılı sekansta baskılanan yağ dokusuna ait alanlar (b,c) etrafında T1A hiperintens T2A hipointens rimi izlenen santrali T1A-T2A hafif hipointens hemorjik yer kaplayıcı oluşum (d). fazladır. Kanama olasılığının diğer belirteçleri tümörün multifokal olması ve ileri derecede vasküler anomali içermesidir (6). Spontan perirenal kanamalı olguların %17-20’sinde neden, AML’dir (7). Olgumuzda da non travmatik AML kanaması mevcuttu. AML’nin büyük boyutta olması spontan rüptür durumunda ciddi kardiyovasküler şok tablosu oluşturabilmektedir. USG, BT ve MRG gibi görüntüleme yöntemlerinin Resim 3: Kontrol BT, hematomda belirgin rezorbsiyon (a, b). yaygın olarak kullanılmaya başlanmasından önce AML’ler temelolarak böbreğin tbül epitel TARTIŞMA karsinomlarından(böbrek hücrelikarsinom) AML terimi ilk kez 1951’de Morgan ve ark. tarafından edilemiyordu. Sonyıllarda USG ve BT ile yağ aberan damarlanma ile değişik miktarlarda düz kas ve dokusunun tanınmasıylalezyonlarınneredeyseneredeyse yağ dokusundan oluşan böbrek tümörünü tanımlamak tamamında doğru tanı konulabilmektedir (1, 8). için kullanıldı (4). Renal AMP’ler yağ dokusu, düz kas Genelde asemptomatik küçük AML’ler (4 cm’den dokusu ve vasküler dokuyu yoğunbir miktarda küçük), dikkatli bir klinik ve radyolojik izleme içerdikleri için kanama açısındanbüyük risk alınabilirler. Büyük tümörler, özellikle semptomatikse, taşımaktadırlar.Çoğunluklaasemptomatik hasta yaşı, komorbiditesi ve diğer faktörler gözönüne olduklarından, büyük oranda tanısı başka sebeplerle alınmak kaydıyla tedavi adayıdırlar. AML’nin akut yapılanradyolojik görüntülemelerdetesadüfen kanamasında konservatif yaklaşım haricinde radyolojik konulmaktadır. AML olgularının %20’si tüberoz olarak arteryal embolizasyon ve uygun hastalarda skleroz (TS) sendromu ile birlikte görülür. Bu cerrahi müdahale alternatifleri mevcuttur (9). sendromda mental retardasyon, epilepsi ve adenoma Burada, nadir bir lezyon olan AML’nin radyolojik sebaseum şeklinde cilt lezyonları vardır. Bizim olarak tanısı ve konservatif tedavi yaklaşımı sunulmuş olgumuzda TS’yi düşündüren bir bulgu yoktu. TS ile olup renal AML’si olan ve akut kanama ile seyreden ilişkili olmayan izole AML’ler genellikle daha büyük, uygun hastalarda konservatif tedavi yaklaşımının soliter, tek taraflı lezyonlardır. Lezyon boyutu 4 cm’den uygulanabilirliğine dikkat çekilmiş 24 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Bayram KAHRAMAN ve ark.

25 KAYNAKLAR 6-Nelson CP, Sanda MG: Contemporary diagnosis and management of 1-Ashebu SD, Dahniya MH, Elshebiny YH, et al. Giant bleeding renalrenal angiomyolipoma. J Urol, 2002; 168: 1315–25. angiomyolipoma: Diagnosis and management. Australasian Radiology7-Millan JC. Tumors of the kidney. In: Hill GS (Editor) Uropathology.New 2002; 46: York: Churchill Livingstone, 1989; Heidenreich A, Hegele A, Varga Z, et al. Nephron-Sparing Surgery for8-Koike H, Muller SC, Hohenfeller R. Management of renal Renal Angiomyolipoma. European Urology 2002;1: angiomyolipoma: A report of 14 cases and review of the literature. Eur 3-Nasir K, Ahmad A. Giant renal angiomyolipomas and pulmonaryUrol 1994;25: lymphangiomyomatosis. Saudi J Kidney Dis Transpl. 2010; 21(2): Walsh P, Retik A, Vaughan D, Wein A. Böbrek tümörleri. İçinde: 4-Morgan GS, Straumfjord JV, Hall EJ. Angiomyolipoma of the kidney. JCampbell üroloji (Eds Anafarta K, Yaman Ö), Ankara: Güneş Kitabevi; Urol. 1951; 65(4): s Chen SS, Lin AT, Chen KK, et al. Renal angiomyolipomaexperience ofYazışma Yazarı: Yrd. Doç. Dr. Cemal Taşdemir 20 years in Taiwan. Eur Urol 1997;32: İnönü Üniversites Tıp Fakültesi, Üroloji Anabilim Dalı 25 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Bayram KAHRAMAN ve ark.

26 Zehra Bozdağ 1, Neslihan Kökten 1, Nurhan Şahin 1, Ayşe Nur Akatlı 1 1 Malatya Devlet Hastanesi Abstract: Elastofibroma is a rare, benign neoplasm most commonly seen in elderly individuals characteristically occuring within subscapular region. The ethiopathogenesis of elastofibroma is mains unknown. It is suggested that this elastic fibers derive from elastotic degeneration of collagen fibers, degeneration of preexisting elastic fibers or an abnormal process of elastic fiber biosynthesis. We describe two cases diagnosed as elastofibrom, one has a lesion in the classic localisation and in the other case the lesion was seen within the extrascapular region (deltoid region). On gross examination the cut surface of the lesions had grey-yellow, solid appereance including are as of fatty tissue. Microscopically the lesion had poorly defined margins, plump, sometimes appeared flower-like, tubular and eosinophilic globules were seen between mature adipocytes and proliferated fibroblasts. Histochemically, degenerated elastic fibres were highlighted by using Verhoeff- vanGieson stain. It is reported because elastofibroma is a rare benign lesion that may be confused clinically with malignant lesions and one of our cases developing site was extrascapular, different from the classic localisation. Keywords: Elastofibroma, Elastic fiber, Verhoeff-vanGieson Özet: Elastofibrom, ileri yaşlarda görülen, karakteristik olarak subskapular yerleşim gösteren, nadir, benign bir neoplazmdır. Elastofibromun etyopatogenezi kesin bilinmemektedir. Bu liflerin kollajen liflerin elastotik dejenerasyonundan kaynaklandığı, var olan elastik liflerin dejenerasyonu ve elastik lif biyosentezindeki bozukluklara bağlı olarak geliştiği gi bi fikirler ileri sürülmektedir. Elastofibrom tanısı koyduğumuz iki olgudan birinde klasik lokalizasyonda yerleşim izlenirken diğer olguda lezyon ekstraskapüler bölgede (omuzda) yerleşim göstermekteydi. Makroskopik olarak lezyonların kesit yüzeyleri yağlı doku alanları içeren kirli beyaz- sarı renkte, solid özellikte izlendi. Mikroskopik olarak; sınırları seçilemeyen lezyonda, matür yağ hücreleri ve prolifere fibroblastlar arasında şişkin, yer yer çiçek benzeri görünümde, tübüler ve eozinofilik globüler yapılar izlendi. Histokimyasal olarak Verhoeff-vanGieson boyası dejenere elastik lifler kolay görünür hale geldi. Elastofibrom, klinik olarak malign lezyonlarla karışabilen nadir bir lezyon olması ve olgularımızdan birinin klasik yerleşim yeri dışında ekstraskapular lokalizasyonda olması nedeni ile sunu lmuştur. Anahtar kelimeler: Elastofibrom, elastik lif, Verhoeff-vanGieson 2 2 Bu olgu sunumu, Kasım 2011’de 21. Ulusal Patoloji Kongresi’nde poster sunum olarak bildirilmiştir 26 ELASTOFİBROMA: 2 OLGU SUNUMU SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Zehra BOZDA Ğ ve ark.

27 OLGU SUNUMU Mikroskopik olarak; sınırları seçilemeyen, matür yağ hücreleri ve prolifere fibroblastlar arasında şişkin, yer Malatya Devlet Hastanesi Patoloji Kliniği’nde yer çiçek benzeri yapılar oluşturan, tubuler ve elastofibrom tanısı almış 2 olgunun parafin blokları eozinoflik globuler yapılar dikkati çekti (Resim 1 ve 2). patoloji arşivinden elde edildi. Olgulara ait klinik Van gieson elastik boyası ile bu yapılarda boyanma bilgilere biyopsi istek formlarından ulaşıldı. Her bir izlendi (Resim 3). olgunun parafin bloklarından 4 mikron kalınlığında Olgu 2: kesitler alındı. Kesitlere H&E, histokimyasal olarak Kırk beş yaşında kadın hasta uzun süredir var olan sol Van Gieson elastik boyası uygulandı. omuzda şişlik şikayeti ile ortopedi kliniğine başvurmuş, Olgu 1: eksize edilen kitle lipom ön tanısı ile laboratuvarımıza Kırk üç yaşında kadın hasta uzun süreden beri var olan gönderilmiştir. sırtta şişlik ve son zamanlarda eklenen ağrı şikayeti ile Makroskopik incelemede; 8.5x5x2.5 cm boyutlarında, genel cerrahi kliniğine başvurmuş. Bu şikayeti ile düzensiz görünümde kesit yüzü sarı, krem renkte, solid operasyona alınan olguda skapulaya yapışık, kasların özellikte lezyon izlendi. içine doğru uzanım gösteren kitle eksize edilerek Mikroskobik olarak; benzer şekilde, sınırları laboratuvarımıza lipom, liposarkom ön tanıları ile seçilemeyen, matür yağ hücreleri ve prolifere gönderilmiştir. fibroblastlar arasında şişkin, yer yer çiçek benzeri Makroskopik incelemede; 11x5x1.5 cm boyutlarında, yapılar oluşturan, tubuler ve eozinofilik globuler yapılar düzensiz sınırlı, kesit yüzeyleri kirli beyaz, sarı renkte gözlendi. Van gieson elastik boyası ile bu yapılarda solid özellikte lezyon izlendi. boyanma.izlendi.boyanma.izlendi. Resim 1: Fibroadipöz doku içerisinde dejenere elastik lifler H&E x40. Resim 2: Tübül ve globül yapıları oluşturan dejenere elastik lifler. H&E x SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Zehra BOZDA Ğ ve ark.

28 Resim 3: Elastik Van Gieson ile dejenere elastik liflerin görünümü. H&E x200. TARTIŞMA almaklabirlikteelastofibrom,karakteristik Elastofibrom, 6-7. dekatlarda pik yapan nadir görülenlokalizasyonu ve histopatolojik görünümü nedeni ile benign bir lezyondur. En sık yerleşim yeri skapulanınkolay tanınabilen bir lezyondur. inferiomediali ile göğüs duvarı arasıdır (1).Elastofibromun etyopatogenezi kesin bilinmemektedir. Ekstraskapular tutulum nadir olmakla birlikte, oralBu liflerin kollajen liflerin elastotik dejenerasyonundan kavite, kolon, omentum, deltoid bölge, kornea, mide vekaynaklandığı, var olan elastik liflerin dejenerasyonu ve rektal submukozal alan diğer bildirim yerleridir (4-10).elastik lif biyosentezindeki bozukluklara bağlı olarak Olgularımızdan birinde skapular bölge, diğerindegeliştiği gibi fikirler ileri sürülmektedir. Bu klasik deltoid bölge tutulumu mevcuttu. Klinik olarakgörüşlerin yanı sıra bazı olgularda aile öyküsünün çoğunlukla yavaş büyüyen, derin yerleşimli, nadirenolması, etkilenen bazı hastalarda da visseral ağrı, hassasiyet ve hareket kısıtlılığına sebep olanlokalizasyonlarda elastofibrom benzeri değişikliklerin lezyonlardır. Olgularımızdan birinde ağrı şikayetigörülmesi genetik yatkınlığı da düşündürmektedir mevcutken diğerinde görülmemiştir.(2,10). Tekrarlayan travma ile ilişkili olması elastik Makroskopik olarak kitle genellikle kötü sınırlı, 5-10liflerindejeneratif bir reaksiyonu olduğunu cm boyutlarındadır. Kesit yüzü gri-beyaz renkte fibrözdüşündürmektedir (11). alanlar içeren yağlı doku görünümündedir. KistikElastofibromtedavisindetedavisindekonservatif eksizyon değişiklikler nadirdir. Sınırlarının düzensiz olması,uygulanır. Lokal rekürrensi nadirdir. Malign çizgili kas ve periosta infiltrasyonu, cerraha sarkomutransformasyon bildirilmemiştir (1). düşündürebilir (1). Her iki olgumuzda da makroskopik olarak lezyonun sınırları düzensiz, kesit yüzeyleri kirlibeyaz, sarı renkte solid özellikte izlendi. Mikroskobik olarak kollajen bantlar arasına dağılmış, elastik boya ile belirginleşen elastik lifler, tipik olarak globül, disk ve çiçek benzeri görünümde izlenirler. Klinik ayırıcı tanıda yumuşak dokunun lipom, sarkom ve hemanjiom gibi diğer yumuşak doku tümörleri yer 28 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Zehra BOZDA Ğ ve ark.

29 KAYNAKLAR: 7-Mirra JM, Straub LR, Jarvi OH. Elastofibroma of the deltoid. A case 1-Enzinger F, Weiss SW, Soft Tissue Tumors,5th ed.,Mosby-YearBook Increport. Cancer. 1974; 33 (1): : Hsu JK, Cavanagh HD, Green WR. An unusual case of elastofibroma 2-Enjoji M, Sumiyoshi k, Sueyoshi K. Elastofibromatous lesion of theoculi. Cornea. 1997; 16 (1): stomach in a patient with elastofibroma dorsi. Am J Surg Pathol. 1985;9-Saint-Paul MC, Musso S, Cardot-LecciaN, Chevialer A, Myx A, Baldini 9(3): E, Michiels JF. Elastofibroma of the stomach. Pathol Res Pract. 2003; 3-Nagamine N, Nohara Y, Ito E. Elastofibroma in Okinawa. A199(9): clinicopathologic study of 170 cases. Cancer. 1982; 50 (9): Goldblum JR, Beals T, Weiss SW. Elastofibromatous change of the 4-Potter TJ, Summerlin DJ, Rodgers SF. Elastofibroma: the initia lreportrectum. A lesion mimicking amyloidosis. Am J Surg Pathol. 1992; in the oral mucosa. Oral Surg Oral Med Oral Pathol Oral Radiol Endod.16(8): ; 97(1): Kara M, Dikmen E, Kara Sa, Atasoy P. Bilateral elastofibroma dorsi: 5-Hayashi K, Ohtsuki Y, Sonobe H, Iwata J, Furihata M, Hikita T, Kishinoproper positioning for an accurate diagnosis. Eur J Cardiothorac Surg T, Akagi T. Pre-elastofibroma-like colonic polyp: another case of colonic2002; 22: polyp. Acta Med Okayama. 1991; 45(1): Yazışma Adresi: Yrd.Doç.Dr. Nurhan ŞAHİN İnönü Üniversitesi Tıbbi 6-Tsutsumi A, Kawabata K, Taguchi K, Doi K. Elastofibroma of thePatoloji Anabilim Dalı. greater omentum. Acta Pathol Jpn. 1985; 35(1): SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Zehra BOZDA Ğ ve ark.

30 Ayşegül KAHRAMAN 1, Caner EDİZ 2, Cemal TAŞDEMİR 2, Bayram KAHRAMAN 3, Ramazan ALTINTAŞ 2, Mustafa KANBAY 4 1 İnönü Üniversitesi, Tıp Fakültesi, Radyoloji AD, Malatya 2 İnönü Üniversitesi, Tıp Fakültesi, Üroloji AD, Malatya 3 Özel Park Hastanesi, Radyoloji Bölümü, Malatya 4 Malatya Devlet Hastanesi, Üroloji Kliniği, Malatya Özet: Seminal vezikül kistleri doğumsal ya da edinsel olarak karşımıza çıkar ve ejekülatuar kanalların tıkanıklığına bağlı oluştuğuna inanılır. Seminal vezikül kistleri nadir olarak görülür ve genellikle bulgu vermezler. Çalışmamızda, her iki yan ağrısı ve prostatizm benzeri şikayetler nedeniyle üroloji kliniğimize başvuran 32 yaşındaki erkek olgu sunulmaktadır. Anahtar kelimeler: Konjenital seminal vezikül kisti, seminal vezikül, semptom. Abstract: Seminal Vesicle Cysts occurs as congenital or acquired and it is believed to be due to obstruction of ejaculatory ducts. Seminal vesicle cysts are rare and usually asymptomatic. In this study, we report a case of Congenital seminal vesicle cyst in a 32-year-old men who presented to the our clinic with bilateral flank pain and prostatism symptoms. Keywords: Congenital seminal vesicle cyst, seminal vesicle, symptoms, 30 KONJENİTAL SEMİNAL VEZİKÜL KİSTİ: OLGU SUNUMU SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Ay şegül KAHRAMAN ve ark.

31 GİRİŞ Seminal veziküller nadir olarak görülmekte olup,manyetik rezonans görüntülemesinde (MRG) veziküla konjenital veya akkiz olarak karşımıza çıkar. Konjenitalseminalis sol kesimde T1 A hiperintens, T2 A seminal vezikül kistleri renal agenezi/disgenezi vehipointens içeriği bulunan, postkontrast kapsüler ektopik böbrek gibi ek anomalilerle birlikte görülebilirkontrastlanma gösteren ve prostat glandı içinde dilate (1). Akkiz kistler ise kronik seminal vezikültübüler yapı şeklinde uzanan kistik yer kaplayıcı oluşum enfeksiyonu, benign prostat hipertrofisi ya da geçirilmişgörüldü. Olgu, veziküla seminalis kisti ve beraberinde prostat cerrahisi sonrasında oluşabilir (2). Seminalsol duktus ejakülatorius obstrüksiyonu şeklinde vezikül kistli olguların çoğu, bulgu vermez. Dizüri,değerlendirildi (Resim 2). ağrılı ejekülasyon ve hematospermi karşılaşılabilecekTARTIŞMA bazı bulgulardır.Seminal veziküller (SV), yaklaşık 12. fötal haftada Bu yazıda, her iki yan ağrısı ve prostatizm benzeridistal mezonefrik kanalın dorsolateral bölümünün şikayetleri olan bir konjenital seminal vezikül kistibülböz karakterde şişmesi sonucunda gelişirler (3). hastasının klinik ve radyolojikbulguları,literatürSeminal veziküllerin fizyolojik işlevitam olarak bilgileri eşliğinde sunulmaktadır.bilinmemesine rağmen,ejakülattakiejakülattakispermlerinspermlerin metabolizmasında ve hareketliliğindeönemli rol OLGUOLGUoynadığı belirtilmektedir (1). SV’nin gelişimi sırasında 32 yaşında erkek hasta, sol kasık ağrısı, idrara sıkek anomalilerin olması, patolojik embriyonik gelişim çıkma, idrarda yanma ve idrardan kan gelmesisürecine bağlıdır. Doğuştan SV kisti olanlarda, şikayetleriyle üroloji kliniğimize başvurdu. Hastanınembiyogenez aşamasında üreter tomurcuğu ile şikayetleri son birkaç gün içerisinde giderek artarakmezonefrik kanalın yakın komşuluklarından, ipsilateral ilerlemişti. Fizik muayenede sağ kostovertebral açırenal agenezi, üreter ektopisi ve aynı taraf testis hassasiyeti saptandı. Kan biyokimya değerleri ve idraryokluğu gibi malformasyonlar da birlikte görülebilir. tetkiki normal sınırlar içindeydi. Hastaya yapılan ürinerBizim olgumuzda da sol renal agenezi vardı. SV kistleri ultrasonografide (USG), sağ böbrek 14,6 cm olarakçoğunlukla asemptomatiktir. Genellikle 5 cm’den izlenirken, sol böbrek görülemedi (sol böbrekbüyükkistlerkistlersemptomatiktir.Asemptomatik agenezisi). Mesane sol posterolateral komşuluğundaolmalarından dolayı, tanısı başka sebeplerle yapılan seminal vekizül lojunda 3,8x2,2 cm boyutlarında tekradyolojik görüntülemelerde tesadüfen konulmaktadır. kalın septa içeren, lobüle konturlu kistik lezyonEskiden SV’lerin değerlendirilmesinde, sadece fizik saptandı. Olguda veziküla seminalis kisti düşünülerekmuayene ve vazografi mevcuttu. Günümüzde ise USG, abdominal bilgisayarlı tomografi (BT) çekildi. Soltransrektal USG, BT ve MRG yöntemleri SV’deki böbrek, abdominal BT’de yine izlenmedi. Mesane solpatolojik durumların tanısında önemli katkı sağlamıştır. posterior lateral bölümde veziküla seminalis lojundaProstatizm semptomları ile başvuran hastamızdaki ilk 3,8x2,2 cm boyutlarında hipodens kistik kitle saptandıklinik tanı, benign prostat hiperplazisi olmuştu. Yapılan (Resim 1). Sonrasında yapılan alt abdomen kontrastlıradyolojik tetkikler sonucu prostat bezi konturları ve 31 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Ay şegül KAHRAMAN ve ark.

32 parankim yapısı normal olup SV kaynaklı bir kistbilgileriyle örtüşen yaşa sahipti. SV kistleri varlığı gösterilmiştir. Hastada eş zamanlı, bir eksemptomatik hale geldiklerinde; en sık abdominal, anomali düşündürecek bulgu yoktu, ancak hastanınperineal ve pelvik ağrı, ejakülasyon sırasında ağrı, spesifik olmayan şikayetleri açısından yapılandizüri, sık idrara çıkma, hematüri ve prostatit benzeri tetkiklerinde sol renal agenezi saptanmıştır. Bu dabulgularla karşımıza çıkar. konjenital seminal vezikül kistlerinde ek anomaliTanı esas olarak radyolojik görüntüleme yöntemleri ile gelişebilme ihtimalini desteklemektedir. Olgumuzdakikonur. USG, her zaman ilk tercih olmalıdır. kist boyutunun 5 cm’den küçük olması, hastanınUygulayıcıya bağımlı olması dezavantajıdır. Eşlik spesifik olmayan semptomlarla başvurmasına nedenedebilecek genitoüriner anomalilerin araştırılması için olmuştur. Çünkü seminal vezikül kistleri genellikle 5intravenöz piyelografi (İVP), BT ve MRG’ye de cm‘ den büyük olduklarında semptomatiktir ve klinikbaşvurulabilir. olarak cinsel olarak aktivitelerinin en fazla olduğu 20-Sonuç olarak, SV kistleri seyrek görülür ve genellikle 30’lu yaşlarda belirgin hale gelebilirler. Bu durumun,asemptomatiktir. Semptomatik kistler tedavi seminal veziküllerde seminal sıvı birikimininedilmelidir. Prostatizm şikayetleri ile başvuran oluşturduğu kistik dilatasyona bağlı olarak ortayaolgularda klinik ayırıcı tanıda SV kistleri de çıktığıçıktığıdüşünülmektedir(4).Olgumuzdadaliteratürdüşünülmelidir. 32 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Ay şegül KAHRAMAN ve ark.

33 KAYNAKLAR 4-Arora SS, Breiman RS, Webb EM, Westphalen AC, Yeh BM, Coakley 1-Williams RD, Sandlow JI. Surgery of the seminal vesicles; In: WalschFV. CT and MRI of congenital anomalies of the seminal vesicles. AJR Am PC, Retik AB, Vaughan EDJr, Wein AJ. Campbell’s Urology. 7nd ed.J Roentgenol 2007; 189: Philadelphia: WB Saun-ders. 1998; 3: Alpern MB, Dorfman RE, Gross BH, et all. Seminal vesicle cysts:YazışmaAdresi:Yrd.Doç.Dr. Ayşegül KAHRAMAN İnönü Üniversitesi Associating with adult polycystic kidney disease. Radiology 1991; 180: 79-Radyoloji Anabilim 80 3King BF, Hattery RR, Lieber MM, Berqu-ist TH, Williamson BJr, Hartman GW.Congenital cystic disease of the seminal vesicle. Radiology 1991; 178: SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Ay şegül KAHRAMAN ve ark.

34 Candan Elmalı 1,Emine Şamdancı(Türkmen) 1,Zeynep Nurkabulov 1,Ayşe Nur Akatlı 1, Nurhan Şahin 1 İnönü Üniversitesi Tıp Fakültesi Tıbbi Patoloji Anabilim Dalı, Malatya Özet: Ksantalezma olarak da bilinen ksantoma, üst gastrointestinal endoskopi sırasında nadiren karşılaşılan benign bir lezyondur. Sıklıkla midede, daha az sıklıkta özefagus, duodenum ve kolonda lokalizedir. Kronik mide ağrısı ve dispepsi şikayetleri ile gastroenteroloji polikliniğine başvuran üç olgu sunulmuştur. Mide endoskopi k biyopsi örneklerinin mikroskopik incelenmesinde lamina propriada gruplar halinde geniş vakuollü sitoplazmalı, bazılarının nükleusları kenara itilmiş hücreler saptanmıştır. İmmünohistokimyasal olarak bu hücreler CD68 ile pozitiflik gösterirken pansitokeratin ile boyanmamışlardır. Histokimyasal olarak Periodik Asid-Schiff (PAS) ve Müsikarmen ile de bu hücrelerde boyanma görülmemiştir. Bu bulgular eşliğinde lezyonlar, ksantoma tanısı aldı. Nadir görülen bu lezyonlar, mikroskopik incelemede taşlı yüzük hücreli karsinomla karışabilmesi nedeni ile sunulmuştur. Anahtar kelimeler: Mide, ksantoma, taşlı yüzük hücreli karsinom. Abstract: Xanthoma also known as xanthelesma is a benign lesion that is encountered rarely during upper gastrointestinal endoscopy. They are frequently located in the stomach and less frequently in esophagus, duodenum and the colon. We report three cases of gastric xanthoma who attended gastroenterology polyclinic with chronic epigastralgia and dyspepsia. Microscopic examination of the gastric biopsy specimens showed groups of cells having large finely,vacuolated cytoplasm, some containing peripherally displaced nucleus, in the lamina propria. Immunohistochemically, these cells stained positive for CD68 and negative for pancytokerain. Histochemically the cells were negative for Periodic Acid-Schiff (PAS) and Musicarmen. These findings indicated that the lesion was xanthoma. These cases are described, because of its rare occurrence and histomorphologically it may be confused with signet ring cell carcinoma. Key words: stomach, xanthoma, signet ring cell carcinom 34 GASTRİK KSANTOMA: NADİR BİR LEZYON SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Candan ELMALI ve ark.

35 GİRİŞ Histokimyasal olarak Periodik Acid-Schiff (PAS) ve Müsikarmen Ksantoma veya bilinen diğer adı ile ksantalezma, üstile bu hücrelerde herhangi bir boyanma olmamıştır. Bu bulgularla gastrointestinal sistem endoskopisi sırasında nadiren karşılaşılanbiyopsi ksantoma olarak rapor edilmiştir. benign bir lezyondur (1). Kadın/erkek oranının eşit olduğunu gösteren yayınlar olduğu gibi kadınlarda ya da erkeklerde daha sıkOlgu 2: görüldüğünü bildiren yayınlar da mevcuttur. GastrointestinalElli dört yaşında erkek hasta kronik epigastrik ağrı ve dispeptik sistemde en sık lokalizasyonu midedir. Endoskopi serilerindeyakınmalarla hastanemize başvurmuş olup üst gastrointestinal gastrik ksantomanın sıklığı %0.018 ile % 0.8 arasındasistem endoskopik incelemesinde fundusta 3mm çapında sarı renkli bildirilmektedir. Otopsi serilerinde ise %58 gibi yüksek bir orandalezyon saptanmıştır. Klinik olarak ksantoma öntanısıyla patoloji bildirilmiştir (2,3). Ancak özefageal ve duodenal ksantomalar çoklaboratuarına biyopsi gönderilmiştir. Histopatolojik olarak lamina daha nadirdir. Morfolojik olarak lipid içeren histiyositlerin varlığıpropriada lenfoid toplulukların varlığı ve köpüksü histiosit benzeri ile karakterize sarı, tümör benzeri lezyonlardır. Ksantomalar,hücreler görülmüştür. İmmunohistokimyasal olarak CD68 ile malign lezyonlarla karışabildiği için hem klinisyen hem de patologpozitif boyanan bu hücreler, Pansitokeratin ile boyanmamıştır. bu konudadikkatliolmalıdırveveendoskopikbiyopsitanıda,tanıda,Histokimyasal olarak Giemsa yöntemi ile H.pylori görülmemiştir. önemlidir.Morfolojik ve immunohistokimyasal bulgular eşliğinde olgu Olgu1:ksantoma olarak tanı almıştır. Altmış dört yaşında kadın hasta, geçmeyen mide ağrısı ve dispepsi şikayetleriilehastanemiz gastroenteroloji polikliniğineOlgu 3: başvurmuştur. Hastaya yapılan mide endoskopik incelemesindeAltmış iki yaşında erkek hasta farklı bir merkezde yapılan mide antrumda yaklaşık 1cm’lik alanda mukozanın kabarık olduğuendoskopik biyopsisinin patolojik incelemesi malignite olarak görülmüş ve malignite öntanısıyla bu alandan biyopsi alınmıştır.raporlandığı için hastanemize sevk edilmiştir. Hazır parafin blok ve %10’luk formalinde tespit edilmiş biyopsi örneklerininkesitlerin mikroskopik incelemesinde lamina propriada grup mikroskopik değerlendirmesinde lamina propriada; geniş granüler-oluşturan histiosit benzeri hücreler, Pansitokeratin ve müsikarmen vakuole sitoplazmalı, bazılarının nukleusları kenara itilmiş hücreile boyanmamıştır. Bu bulgular eşliğinde olgu kronik gastrit ve topluluklarısaptanmıştırsaptanmıştır(Resim(Resim1 ve2).Yapılanksantoma olarak tanı almıştır. immünohistokimyasal incelemede bu hücreler CD68 ile pozitifResim 1: Lamina propiada geniş sitoplazmalı, yuvarlak nukleuslu boyanmış olup pansitokeratin ile boyanmamıştır (Resim 3).hücreler (H&E X200). 35 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Candan ELMALI ve ark.

36 Resim 1: Lamina propiada geniş sitoplazmalı, yuvarlak nukleuslu hücreler (H&E X200). Resim 2: Bazısı taşlı yücük hücrelerine benzeyen granüler-küçük vakuollü hücreler (H&E X400). Resim 3: Lamina propriada CD 68 antikoru ile boyanmış hücreler. CD68 X SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Candan ELMALI ve ark.

37 değerlendirmede lamina propriada köpüksü histiyositlerin varlığı ile karakterizedir. Bu mikroskopik görünüm, taşlı yüzük hücreli karsinomda görülene benzediği için ayırıcı tanı oldukça önemlidir (10). İmmünohistokimyasal olarak kullanılan antikorlar ile makrofajlar, taşlı yüzük hücrelerinden kolaylıkla ayrılır. Bizim olgularımızda da histiyosit belirleyicisi olan CD68 antikoru ile pozitif boyanma, epitelyal belirleyicilerden olan pansitokeratin antikoru ile boyanmanın olmayışı ile ksantoma tanısı konmuştur. Literatürde ksantomların midede sıklıkla antrumda ve prepilorik bölgede yerleştiğinden bahsedilmektedir (3). Bizim olgularımızdan biri antrum diğeri fundus yerleşimliydi. Olgularımızda ksantomaya kronik gastrit eşlik ederken H.pylori birlikteliği görülmemiştir. Ksantomalar benign lezyonlar olmakla birlikte nadir de olsa gastrik adenokarsinomlar ve prekanseröz lezyonlarla da birliktelik gösterebilmektedirler. Tümör ile birlikteliği yok ise takip veya tedavi gerekmemektedir (11).Oldukça nadir ve benign olan bu lezyon başta taşlı yüzük hücreli karsinoma olmak üzere bazı gastrik TARTIŞMA Feyrter, gastrik mukozada yağsı birikimleri içeren küçük sarı makülü, ilk bildiren kişidir (4). Lubarsch and Borchardt 1929 yılında, gastrik mukozada saptanan lipid adacıklarını gastrik ksantoma olarak adlandırdılar (5).Etyopatogenezinde kronik gastrit, H. pylori infeksiyonu, gastrik anastomoz, diabetes mellitus, intestinal metaplazi sorumlu tutulmuştur. Hiperlipidemi ve hiperkolesterolemi ile ilişkili olabileceği düşünülmekle birlikte ikisi arasında kesin bir bağlantı gösterilememiştir (6,7). Ancak Young Yi çalışmasında gastrik ksantomalar ile dislipidemi ve atrofik gastrit arasında ilişki olduğunu ancak H.pylori enfeksiyonu ile ilişkili olmadığını bildirmiştir (8). Ksantomaların patogenezi hala aydınlatılamamışolmasınarağmenrağmenbozulanbozulanhücre membranlarından açığa çıkan lipidlerin, mukozal hasara bir yanıt olarak ortaya çıkan intestinal histiyositler tarafından yakalanması sonucunda geliştiği düşünülmektedir (3).Ksantoma endoskopik olarak 1-10 mm çapında, sarı-beyaz renkli, iyi sınırlanmış, tek veya malignitelere yapılırken benzeyebildiğinden histopatolojikdeğerlendirme tutulmalıdır. multiplmultiplnodüllerveyaplaklarşeklindedir(9).Histopatolojikayırıcıtanıdatanıdaakılda 37 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Candan ELMALI ve ark.

38 Kaynaklar: 1. Kaiserling E, Heinle H, Itabe H, Takano T, Remmele 7. Isomoto H, Mizuta Y, Inoue K, Matsuo T, Hayakawa T, Miyazaki M, Onita K, Takeshima F, Murase K, W. Lipid islands in human gastric morphological and immunohistochemical Gastroenterology 1996;110: mucosa: findings. Shimokawa I, Kohno S. A close relationship between Helicobacter pylori infection and gastric xanthoma. Scand J Gastroenterol 1999; 34(4): Yi SY. Dyslipidemia and H pylori in gastric xanthomatosis World J Gastroenterol 2007 September 14; 13(34): Jeong YS, Park H, Lee DY et al. Gastric xanthomatosis. Gastrointest Endosc 2004; 59: Oviedo J, Swan N, Farraye FA. Gastric xanthomas. Am J Gastroenterol 2001; 96: Petrov S, Churtchev J, Mitova R, Boyanova L, Tarassov M. Xanthoma of the stomach-some morphometrical peculiarities and scanning electron microscopy. Hepatogastroenterology 1999;46: 1220–2. 3.Gencosmanoglu R, Sen-Oran E, Kurtkaya-Yapicier O, Tozun N. Xanthelasmas of the upper gastrointestinal tract. J Gastroenterol 2004; 39: Feyrte F. Herdformige lipoidablagerung in der shcleimhaut des magens: Lipoidzell-enknotchern in der schleimhaut des darmes. Virchows Arch Pathol Anat 1929; 273: Lubarsch O, Borchardt H. Atrophie und Sogenannte Degeneratronen des Magens und Darmes. In: Henke F, Lubarsch O, eds. Handbuch der speziellen Pathologischen Anatomie und Histologie. Berlin: Verlag von Julius Springer, 1929: Gürsoy Ş, Yurci A, Torun E, Soyuer İ, Güven K, Özbakır Ö, Yücesoy M. An uncommon lesion: Gastric Xanthelasma. Turk J Gastroenterol 2005; 16 (3): Jansen HJ, van Krieken JH, Römkens TE. Yellow- white lesions in the upper gastrointestinal tract. Gastric xanthelasmas. Neth J Med Nov;67(10): Yazışma Adresi : Uzman Dr. Ayşenur Akatlı İnönü Üniversitesi Tıbbi Patoloji Anabilim Dalı. 38 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Bayram KAHRAMAN ve ark.

39 Seda TAŞDEMİR İnönü Üniversitesi Tıp Fakültesi Farmakoloji AD Özet: İlaçların akılcı olmayan kullanımı hem gelişmiş, hem de gelişmekte olan ülkelerde ciddi tıbbi ve ekonomik sorun olusturmaktadir. Ülkemizde ilaç kullaniminda büyük israf yapildigi günlük gözlemlerimizde izlenmektedir. Bu konuda hekimlerin gereksiz ilaç kullanimini yönlendirmelerinin yanisira hastalarin ilaçlara hekim disi yollar ile kolayca ulasmalari ve hastalarin ilaçlarini düzenli kullanmamalari rol oynamaktadir. Akılcı ilaç kullanımı (rasyonel farmakoterapi) hastaya doğru tanının konması, sorununun dikkatlice tanımlanması, tedavi amaçlarının belirlenmesi, değişik seçenekler içinden etkinliği kanıtlanmış (güvenilir) tedavinin seçilmesi, uygun bir reçete yazılması, hastaya açık bilgiler ve talimatlar vererek tedaviye başlanması, tedavinin sonuçlarının izlenmesi ve değerlendirilmesini kapsayan sistematik bir yaklaşım biçimidir. İlaç ancak doğru kullanılırsa etkilidir ve akılcı ilaç kullanımına yönelik kararların verildiği her kademede, ilaç bilgisine ihtiyaç vardır. Hangi ilacın kullanılacağına karar veren hekim, ilacı uygun şartlarda sağlayan eczacı ve ilacı uygulayan hemşire veya hasta, akılcı ilaç kullanımının sağlanmasında sorumluluk sahibi taraflardır. Anahtar kelimeler: akılcı ilaç kullanımı, doğru tanı, uygun tedavi Abstract: Irrational use of drugs is a common medical and economical problem in both developing and improved countries. A great waste of drug use in our country has been observed on daily practise. In this regard, irrational use of drugs by doctors, easy access to drugs and not to use the drugs regularly by the patients are involved. Rational use of drug including true diagnosis for patients, describing the problem carefully, determing goal of the treatment, starting the treatment after giving sufficient/appropriate information, monitoring and evaluation of the results of treatment is a systematic approach. Drugs are effective just when they are used correctly and the information about drugs is need to all steps given decision for rational use of medicines. The doctor decide which drug is used, the pharmacist provide drugs in appropriate conditions, the nurse and patient carry out medicines are responsibles for rational use of medicine. Key words: Rational use of drug, true diagnosis, appropriate treatment 39 AKILCI (RASYONEL) İLAÇ KULLANIMI SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Seda TA ŞDEMİR

40 GİRİŞ 1985 yılında Nairobi’de yapılan Dünya Sağlık Örgütükullanılmasıdır. Rasyonel ilaç kullanımı, ucuz ya da toplantısı akılcı ilaç kullanımı çalışmaları için başlangıç indirimli ilaç kullanımı anlamına gelmez. sayılmaktadır. Bu toplantıda Akılcı İlaç Kullanımı; Rasyonel ilaç kullanımı, ayrıca, tümüyle standardize "Kişilerin klinik bulgularına ve bireysel özelliklerine edilmiş hastalıkların aynı biçimde tedavisi için salt göre uygun süre ve dozajda, en düşük fiyata ve kolayca teorik kavramların tartışmasız uygulaması da değildir. sağlayabilmeleri" olarak tanımlanmıştır (1). Bir sağlık Rasyonel tedavinin de önemli bir parçasını oluşturan hizmeti uygulaması olarak Rasyonel ilaç tedavisinden rasyonel ilaç kullanımının temelinde, hastanın birey başlıca beklenti doğru, etkin ve hızlı ilaç tedavisi ile olarak kabul edilmesi, tıbbi bilgi ve kararlar ile tedavi hizmetlerinde etkinlik ve güvenliğin artması ve ekonomik yaklaşımlar bulunur.” (3). genel sağlık harcamalarında azalma ve tasarruf sağlanmasıdır (2). Tüm dünyada olduğu gibi ülkemiz için de ciddi bir sorun olan etkisiz, yanlış ve gereksiz ilaç kullanımının DPT VIII. 5 Yıllık Kalkınma Planı İlaç sanayii Özel giderek artması, bu konuda yaşanan sorunlara daha İhtisas Komisyonu raporunda“Rasyonel İlaç ciddi yaklaşılmasını bir zorunluluk haline getirmiştir. Kullanımı” na ilişkin aşağıdakiparagraflar yer Sağlık Bakanlığınca, akılcı ilaç kullanımında mevcut almaktadır: “Son elli yıl içinde,eskiden tedavisi durumun değerlendirilmesi amacı ile Erzurum, Bolu ve mümkün olmayan pek çok hastalıkta etkili çok sayıda Adıyaman illerinde yapılan çalışmalarda reçetelerin ilacın tıbbi kullanıma girmesi, kullanıma giren ilaçların hem maliyet hem de kutu sayısı bazında %50’nin daha etkili ve güvenli olan yenilerinin sürekli olarak üzerinde akılcı olmadığı (irrasyonel) tespit edilmiştir. geliştirilmesi, hastalığın ve hastanın durumuna göre Sonuç olarak, iki ilaçtan biri yanlış ya da gereksiz ilacın akılcı ve doğru bir şekilde inceleyip tanı reçete edilmektedir (4). Hastasının durumunu etraflı bir koyduktan sonra mevcut ilaçlar arasından en uygununu şekilde inceleyip tanı koyduktan sonra mevcut ilaçlar seçecek ve buna göre reçete yazacak olan sorumlu kişi arasından en uygununu seçecek ve buna göre reçete hekim olduğundan, hekimin yükümlülüğü ve davranışı yazacak olan sorumlu kişi hekim olduğundan, hekimin rasyonel ilaç kullanımının birincil önemdeki ögesini yükümlülüğü ve davranışı rasyonel ilaç kullanımının oluşturur. birincil önemdeki öğesini oluşturur. İlacın yasal olarak Rasyonel ilaç kullanımı, ilaçların akıllıca kullanımıtemin edileceği tek mesleki-kamusal alan ise eczanedir. anlamına gelir. Diğer bir değişle, bir hastalığınEczanelerde hekim reçetesine bağlı olan, ya da reçetesiz önlenmesi, kontrol altına alınması veya tedavi edilmesiverilebilen ilaçlar mevcuttur. Bu iki kategoriye ait için, doğru ilacın, gereken anda, gerektiği miktarda veilaçların hastaya sunumu ve hastanın bilgilendirilmesi uygun fiyatla kullanılmasıdır. İlacın hem kullanana,eczacıya ait bir sorumluluktur. Eczacı bu sorumluluğu hem de ulusal ekonomiye en yararlı biçimdeile akılcı ilaç kullanımında önemli bir görev de üstlenmektedir. Hastane ve poliklinik hizmetlerindeki 40 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Seda TA ŞDEMİR

41 ilaç kullanımında da, hekim ilk sorumluluk sahibiUygunsuz ilaç kullanımında antibiyotikler başı olmakla beraber ilaca ilişkin bilginin pekiştirilmesindeçekmektedir. Ülkemizdeki durumla dünyadaki gerçeğe eczacı, hemşire ve diğer sağlık personelinin de rolübakacak olursak; ülkemizde antibiyotikler en çok bulunmaktadır. Bu nedenlerle, yalnızca hekimlerinkullanılan ilaç grubu iken dünyada 4. sırada yer aldığını değil, yukarıda sözü edilen tüm sağlık hizmeti görmekteyiz (Tablo 1) (7). gruplarınıngerekgerekmezuniyet–öncesi,gerekse mezuniyet–sonrası dönemlerde, rasyonel ilaç kullanımı ilkeleri ve kendilerine düşen rol açısından eğitilmeleri esastır (5). Türkiyede Akılcı Olmayan İlaç Tedavisi Örnekleri Dünya Sağlık Örgütü verileri, dünyada ilaçların yaklaşık %50'sinin yanlış ya da gereksiz kullanıldığını veya kutusu bile açılmadan çöpe atıldığını gösteriyor. T.C. Sağlık Bakanlığı İlaç ve Eczacılık Genel Tablo 1. Dünyada ve Türkiyede en çok satılan Müdürlüğü, bu oranların Türkiye için de geçerli olduğunu belirtiyor. Ayrıca T.C. Sağlık Bakanlığı, Tıp ilaçların karşılaştırılması Kurumu Derneği ve Türkiye Eczacılar Birliği'nin verilerine göre eczanelerdeki ilaçların ortalama %7'si kullanma süresi dolduğu için israf ediliyor (6). Türkiyede akılcı olmayan ilaç tedavisi örnekleri iyi4-Her türlü dispepside H2-reseptör blokeri veya proton planlanmış kapsamlı araştırmalarla incelenebilmiş pompası inhibitörlerinin kullanımı değildir. Oysa bir sorunun çözülebilmesi için öncelikle 5-Esansiyel hipertansiyonda tek ilaçla tedavi sorunun iyi tanımlanmış ve değerlendirilmiş olması denenmeden çoklu ilaç tedavisi gereklidir. Yapılan sınırlı sayıdaki araştırma sonuçlarına göre ülkemizde, akılcı olmayan ilaç tedavisi ile ilgili 6-Gereksiz aşılama (65 yaş altı sağlıklı erişkinlerde grip örnekler: aşısı) 1-Çocuk ishallerinde antibiyotik tedavisi 7-Analjeziklerin suistimali 2-Fonksiyonel kabızlıkta laksatif alışkanlığı 8-Vitaminlerin suistimali (Her antibiyotikle birlikte ve soğuk algınlığı, nezle, grip gibi durumlarda vitamin 3-Astımda uzun etkili β2 -reseptör agonistlerinin alma alışkanlığı) uygunsuz kullanımı 41 En Çok Satılan İlaçlar DünyadaTürkiyede Kalp-damar % 19.3Antibiyotik % 19.0 Santral SS % 15.8Ağrı kesici % 12.0 Metabolik % 15.3Romatizma % 11.0 Antibiyotik % 9.9Soğuk algın. % 8.6 Solunum S. % 9.3Vitamin % 7.3 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Seda TA ŞDEMİR

42 9-Ayırıcıtanıtanıyapmadan gereksizilaç etkileşimleri), uygunluk (kontrendikasyonlar, saklama- kullanım kolaylığı) ve tedavi maliyeti açısından birbirleriyle karşılaştırılmalı ve en iyi seçenek belirlenmelidir. kombinasyonlarının kullanılması 10- Hastaya hastalığı ve tedavisi hakkında yeterince bilgi verilmemesi 5-K(işisel)-ilacın seçilmesi gereklidir. Bir önceki analiz sonucunda karar verilen ilaç grubunun içinden, yine aynı ölçütler kullanılarak (etkinlik, güvenlik, uygunluk, maliyet) bir ilaç molekülüne karar verilmelidir. 11- İlaçsız tedavinin de yerine göre ilaçla tedavi kadar önemli olduğunun yeteri kadar anlatılmamasıdır (8). 6-Anlaşılması kolay bir reçete hazırlanmalı ve düzenli olarak tedavi gözden geçirilmeli ve gereksiz ilaçlar tedaviden çıkarılmalıdır. Genelde hastaların %50 si reçete edilen ilaçları ya doğru uygulamazlar, ya düzensiz kullanırlar ya da hiç kullanmazlar. Bunun önemli sebepleri arasında semptomların geçmesi, yan etkilerin oluşması, ilacın beklendiği kadar etkili olmaması ve doz şemasının özellikle yaşlılar için karmaşık olması sayılabilir. Akılcı ilaç tedavisi kararının başarıya ulaşması, hastanın tedaviye uyumu ile doğrudan ilişkilidir. Hastanın tedaviye uyumu şu üç yolla artırılabilir: iyi seçilmiş bir ilaç tedavisi; iyi bir hasta-hekim ilişkisi; önemli bilgi, talimat ve uyarılar için zaman ayrılması (9). Akılcı İlaç Kullanım İlkeleri Kişilerin klinik bulgularına ve bireysel özelliklerine göre uygun ilacı, uygun süre ve dozajda, en düşük fiyata ve kolayca sağlayabilmeleri olarak tanımlanan akılcı ilaç kulanımının temel ilkeleri: 1-Tedaviyi planlarken doğru tanıya dayanmak Doğru ve erken tanı başarılı bir tıbbi tedavinin ön koşuludur. Ayrıca, yanlış başlanmış bir tedavinin doğru tanıyı gölgeleyip geciktirebileceği de unutulmamalıdır. 2-Tedavi hedeflerini belirlemek. Tedaviyle neyi amaçlıyoruz? İlaç tedavisine gerek var mı? Tüm İlaç kullanımının bir hekimlik sanatı olduğunu unutmamalıdır. Çünkü, önceki kuşakların terapi ya da farmakoterapi olarak adlandırdıkları bu uygulamada hastanın koşullarını ve var olan tıbbi olanakları doğru değerlendirmekten öte, hekimin kararının sunumu ve uygulanması anlamında “hekimlik san’atinin” ayrı bir önemi vardır (10). Öncelikli olarak halkın sağlığını ve toplumun çıkarını gözeten akılcı ilaç kullanımı konusunda dünyada ve Türkiye’de belli bir yol alınsa da ilaçların kullanım sorunları devam etmektedir. AİK bilincinin aşılanması için basta hekimler olmak üzere, eczacı ve bu konuda hizmet veren sektörün toplum bilincini arttırmaya yönelik örgün ve yaygın eğitim olanakları kullanılmaya ve geliştirilmeye devam edilmelidir. hastalıklar ya gerektirmeyebilir. başlamadan önce Böylece hastanın dadayakınmalar ilaç tedavisi Tedavi amaçlarının, tedaviye hastayla konuşulması iyi olabilir. kendi hastalığının sebebi, tanısı, tedavisi ile ilgili birçok şeyi fark etmesi sağlanarak tedaviye uyumu artırılabilir. 3-Hastanın kullandığı diğer ilaçlar ve alışkanlıkları sorgulanmalıdır. Kullanılmakta olunan tüm ilaçların bilinmesi gerekir. Ayrıca sigara, alkol kullanımı da ilaç etkilerini değiştirebilir. 4-Etkili ilaç gruplarının listesinin yapılması, ölçütlere göre etkili bir ilaç seçilmesi Tedavide kullanılacak ilaç grubuna karar verirken dört adet ana özellik göz önünde bulundurulmalıdır. Rasyonel farmakoterapi ilkeleri doğrultusunda hekimi tedavi hedeflerine ulaştırabilecek ilaç seçenekleri etkinlik (yeterli doz, süre), güvenlilik (yan etki, ilaç 42 SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Seda TA ŞDEMİR

43 KAYNAKLARKAYNAKLAR6-ATO(2006).İlaçtaİsrafraporu. 2006; 1-Sercan Bulut Çelik, Hüseyin Can. Birinci basamakta akılcı ilaçhttp:/ w.atonet.org.tr/turkce/bulten/bulten.phphttp://www.atonet.org.tr/turkce/bulten/bulten.php3?sira=438. kullanımı. Smyrna Tıp Dergisi Sağlıkbakanlığıakılcıilaçkullanımı 2-Prof. Dr. Nurettin Abacıoğlu. Akılcı (Rasyonel) İlaç Kullanımı. Bilim,http:/ w.saglik.gov.tr/TR/belge/1-7771/akilci-ilac-kullanimi.htmlhttp://www.saglik.gov.tr/TR/belge/1-7771/akilci-ilac-kullanimi.html. Eğitim ve düşünce dergisi Aralık 2005; 5(4).8-Kayaalp SO. Akılcı Tedavi Yönünden Tıbbi Farmakoloji, Editör: SO 3-DPT VIII. 5 Yıllık Kalkınma Planı İlaç sanayii Özel İhtisas KomisyonuKayaalp, 13. Baskı, Pelikan Yayıncılık, 2012, pp Raporu Alper İskit. Akılcı İlaç Kullanımı. Sürekli Tıp Eğitimi Dergisi. 2006; 4-Akılcı İlaç Kullanımı Çalıştayı Sonuç Raporuı T.C. Sağlık Bakanlığı15(7). Refik Saydam Hıfzıssıhha Merkezi Başkanlığı Hıfzıssıhha Mektebi10-Esat Eşkazan. Akılcı ilaç kullanımı. Akılcı İlaç akullanımı Sempozyumu Müdürlüğü 2006.İstanbul 1999; s Oktay Ş ve Kayaalp SO. Rasyonel Tedavi Yönünden Tıbbi Farmakoloji, Editör: SO Kayaalp, 11. Baskı, Hacettepe-Taş Kitabevi, 2005, pp Yazışma adresi: Seda TAŞDEMİR İnönü Üniversitesi Tıp Fakültesi Farmakoloji AD SA Ğ LIK H İ ZMETLER İ MESLEK YÜKSEKOKULU DERG İ S İ 2013 VOL.4 C İ LT 1 Seda TA ŞDEMİR


"Sağlık Hizmetleri Meslek Yüksekokulu Dergisi İnönü Üniversitesi Adına Sahibi: Owner on behalf of İnönü University: Editör/Editor: Doç.Dr.Emine ŞAMDANCI." indir ppt

Benzer bir sunumlar


Google Reklamları