Sunum yükleniyor. Lütfen bekleyiniz

Sunum yükleniyor. Lütfen bekleyiniz

Bazı Citrus Türlerinde Amonyum (NH 4 + ) Transport Proteinlerinin In Silico Analizi Muavviz AYVAZ, Çiğdem YAMANER, Murat Kemal AVCI, Hüseyin UYSAL, Emre.

Benzer bir sunumlar


... konulu sunumlar: "Bazı Citrus Türlerinde Amonyum (NH 4 + ) Transport Proteinlerinin In Silico Analizi Muavviz AYVAZ, Çiğdem YAMANER, Murat Kemal AVCI, Hüseyin UYSAL, Emre."— Sunum transkripti:

1 Bazı Citrus Türlerinde Amonyum (NH 4 + ) Transport Proteinlerinin In Silico Analizi Muavviz AYVAZ, Çiğdem YAMANER, Murat Kemal AVCI, Hüseyin UYSAL, Emre SEVİNDİK a Adnan Menderes Üniversitesi, Ziraat Fakültesi, Tarımsal Biyoteknoloji Bölümü, Güney Kampüsü, Çakmar-AYDIN, TÜRKİYE GİRİŞ Bitkiler büyüme ve gelişmeleri için gerekesinim duydukları azotu (N) ortamdan amonyum (NH 4 + ) ve nitrat (NO 3 - ) iyonları şeklinde kökleri aracılığıyla alırlar. Azot bitkiler için gerekli mineral maddeler arasında en fazla gereksinim duyulan elementtir. Her iki bileşik ortamda eşit miktarda bulunduğunda bitkilerin amonyumu (NH 4 + ), nitrata (NO 3 - ) göre daha hızlı aldığı ortaya konmuştur. Amonyum (NH 4 + ) bitkiler tarafından plazma membranında bulunan amonyum transport taşıyıcıları tarafından alınır. Ülkemizin sahip olduğu iklim ve ekolojik koşullar birçok citrus tür ve çeşidinin üretimine imkan sağlamaktadır. Turunçgiller Dünyada en çok yetiştirilen ve tüketilen meyve grubu arasında yer almaktadır. Citrus cinsine ait türlerin meyvelerinden gıda olarak yararlanıldığı gibi kabuklarından, yapraklarından ya da çiçeklerinden parfümeri sanayiinde kullanılan uçucu yağlar da elde edilmektedir. Bu çalışmadaki amacımız bitki beslemede oldukça önemli bir yere sahip amonyum azotunun bitkilere alınımı sağlayan amonyum transport proteinlerinin In silico analizinin gerçekleştiril- mesidir. Çalışma sonucunda elde edilecek bulgular; amonyum transport gen ve proteinlerinin citrus türleri özelinde detaylı bir şekilde anlaşılmasını kolaylaştırması ve konu ile ilgili bilimsel bir temel oluşturması hedeflenmektedir. Şekil 3: Protein dizilerine dayalı oluşturulan filogenetik ağaç Tablo 1. Expasy ProtParam verileri Şekil 1: Citrus türlerinde tespit edilen motifler Kaynaklar 1.Gasteiger E, Hoogland C, Gattiker A, Duvaud S, Wilkins MR, Appel RD, Bairoch A (2005) Protein identification and analysis tools on the ExPASy server, In: Walker JM (ed): The Proteomics Protocols Handbook, Humana Press, 571– Bailey TL, Boden M, Buske FA, Frith M, Grant CE, Clementi L, Ren J, Li WW, Noble WS (2009) MEME SUITE: tools for motif discovery and searching. Nucleic Acids Research 37(s2): W202-W Koichiro Tamura, Glen Stecher, Daniel Peterson, Alan Filipski, and Sudhir Kumar (2013) MEGA6: Molecular Evolutionary Genetics Analysis version 6.0. Molecular Biology and Evolution: Saitou N, Nei M (1987) The neighbor-joining method: a new method for reconstructing phylogenetic trees. Molecular Biolology and Evolution 4(4): MATERYAL ve METOT Bu çalışmada Citrus sinensis (Portakal) ve Citrus clementina (Klemantin mandarini) türlerine ait 22 adet amonyum transport protein dizisi Dünya Gen Bankasından (NCBI) (http://www.ncbi.nlm.nih.gov) FASTA formatında elde edilerek, In silico analizler gerçekleştirilmiştir. Daha sonra Amonyum transport proteinlerine ait dizilerin Expasy ProtParam (web.expasy.org/ protparam) aracılığıyla molekül ağırlıkları, amino asit sayıları, alifatik indeksleri, instabilite indeksleri, extinction coefficient ve GRAVY değerleri hesaplanmıştır [1]. Amino asit dizilerine ait motifler, MEME ve MAST (http://meme.nbcr.net/meme3/meme.html) [2] araçlarıyla ortaya konmuştur. Filogenetik analiz- ler, MEGA 6 programında Neighbour-Joining (NJ) ağacı şeklinde elde edilmiştir [3,4]. Şekil 2: Citrus türlerinde bulunan motifler Şekil 4: Amino asit dizilerinin hizalanması BULGULAR Proteinlere ait molekül ağırlığı ile kDa arasında, amino asit sayısı (aa), 513 ile 321 arasında, ile arasında, instabilite indeksi (II) ile arasında, extinction coefficient ile , alifatik indeks (AI) ile arasında ve GRAVY değerleri ile arasında değişmektedir. Birbirinden farklı 5 motif bulunmuştur. Elli (50) amino asitlik “IHVSSGIAGLTAAY WVGPRLKSDKERFPPNNVLLMLAGAGLLWMGWSG FN” ve “ICWVLVCYRMAFGDQLLPFWGKGAPAL GQKYLVGRARVPESTHEVDGKTV” en uzun olan motiflerdir. Filogenetik analizler sonucunda oluşturulan Neighbour-Joining (NJ) ağacı iki claddan oluşmuştur. SONUÇ ve TARTIŞMA Dünyada en çok tüketilen meyveler arasında bulunan citrus türlerine ait yapılan çalışmalar bilimsel literatürde hiç kuşkusuz önemli bir yer teşkil etmektedir. Ayrıca bitki besleme element- leri arasında en fazla gereksinim duyulan azot’un alınımı çalışmaları da önemli bir yere sahiptir. Bu noktadan hareketle iki farklı citrus türüne ait amonyum transport proteinlerinde gerçekleş- tirilen in silico analizler proteinlerin daha detaylı bir şekilde anlaşılmasına ve gelecekteki çalışmalara bilimsel temel oluşturacaktır. Organizma NCBI Accession Numarası Sekans Uzunluğu Moleküler Ağırlık pl -R +R EC IIAlGRAVY 1Citrus clementinaESR Citrus sinensisorange1.1g011335m Citrus clementinaESR Citrus sinensisorange1.1g041074m Citrus clementinaESR Citrus sinensisorange1.1g043627m Citrus clementinaXP_ Citrus sinensisorange1.1g040022m , Citrus clementinaESR Citrus sinensisorange1.1g044248m Citrus sinensisorange1.1g044779m Citrus sinensisorange1.1g017570m Citrus clementinaESR Citrus clementinaESR Citrus clementinaESR Citrus sinensisorange1.1g044092m Citrus clementinaXP_ Citrus sinensisorange1.1g044901m Citrus sinensisorange1.1g012033m Citrus clementinaESR Citrus sinensisorange1.1g020780m Citrus clementinaESR MOTIF UZUNLUK MOTİF IHVSSGIAGLTAAYWVGPRLKSDKERFPPNNVLLMLAGAGLLWMGWSGFN 2 41 KGDSAWQMTASTLVGIQSMPGLLIIYASIVKKKWAVNSAFM 3 26 SVIGAVQGMMTGLVCITPGAGLVQSW 4 35 LVYFQFTFAAITVILLAGSVLGRMNIRAWMAFVPL 5 50 ICWVLVCYRMAFGDQLLPFWGKGAPALGQKYLVGRARVPESTHEVDGKTV Motif 1 Motif 2 Motif 3 Motif 4 Motif 5


"Bazı Citrus Türlerinde Amonyum (NH 4 + ) Transport Proteinlerinin In Silico Analizi Muavviz AYVAZ, Çiğdem YAMANER, Murat Kemal AVCI, Hüseyin UYSAL, Emre." indir ppt

Benzer bir sunumlar


Google Reklamları